Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343038.1 | Gene: | pex7 / 5802962 | PomBaseID: | SPAC17D4.01 | Length: | 308 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 223 | Identity: | 56/223 - (25%) |
---|---|---|---|
Similarity: | 97/223 - (43%) | Gaps: | 55/223 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MALPRKLISKIYDIKAHDSRVTSLDLGETG-RVLVTGGEDRNVNLWA-----------IGQNECF 53
Fly 54 MSLTGHNRS--------------------------------IDCVRFAYKDN--FVYSADDIGII 84
Fly 85 RRWDL-NSQKIYSTLNGHMKSVRTL-DFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSH 147
Fly 148 VNSVKFSP--DGLWIASAGLEGSILIWD 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
WD40 | <4..330 | CDD:225201 | 56/220 (25%) | ||
WD40 | 14..260 | CDD:238121 | 52/210 (25%) | ||
WD40 repeat | 22..58 | CDD:293791 | 10/47 (21%) | ||
WD40 repeat | 63..99 | CDD:293791 | 11/38 (29%) | ||
WD40 repeat | 106..142 | CDD:293791 | 9/36 (25%) | ||
WD40 repeat | 148..184 | CDD:293791 | 13/28 (46%) | ||
WD40 repeat | 192..228 | CDD:293791 | |||
WD40 repeat | 285..310 | CDD:293791 | |||
pex7 | NP_001343038.1 | WD40 | 35..>306 | CDD:225201 | 55/221 (25%) |
WD40 repeat | 65..101 | CDD:293791 | 4/14 (29%) | ||
WD40 repeat | 106..143 | CDD:293791 | 8/36 (22%) | ||
WD40 repeat | 151..185 | CDD:293791 | 2/33 (6%) | ||
WD40 repeat | 192..230 | CDD:293791 | 11/38 (29%) | ||
WD40 repeat | 236..273 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 279..305 | CDD:293791 | 11/25 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |