DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and pex7

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001343038.1 Gene:pex7 / 5802962 PomBaseID:SPAC17D4.01 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:56/223 - (25%)
Similarity:97/223 - (43%) Gaps:55/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALPRKLISKIYDIKAHDSRVTSLDLGETG-RVLVTGGEDRNVNLWA-----------IGQNECF 53
            :.:|.|.|.|   .|.|.:.:.::|..... |::|||..|..:.||.           .|.|...
pombe    89 LTMPSKPIHK---WKEHKAEIVAIDTNTVDRRIVVTGSWDGTIKLWLGNLPNSVQTLNNGSNSRI 150

  Fly    54 MSLTGHNRS--------------------------------IDCVRFAYKDN--FVYSADDIGII 84
            :::..|..|                                |.|:.:: |.|  .||:||:..::
pombe   151 LTVATHYSSPNLLGYTSSDGLCKFWDFRSSDKFMSIEIPNQITCMNWS-KSNHRMVYTADNNNLV 214

  Fly    85 RRWDL-NSQKIYSTLNGHMKSVRTL-DFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSH 147
            ..:|: |.:...|.|:||..:||:: ..|.:.:.:.:.|.|.|.|::|.: :::||:....|...
pombe   215 YCYDIANLKTPLSVLSGHQLAVRSIKSSNSAHDLLATASYDMTSRIFDPE-QHSCIRKVDLHSEF 278

  Fly   148 VNSVKFSP--DGLWIASAGLEGSILIWD 173
            |..|.:|.  ||.||||.|.:.|:.||:
pombe   279 VRDVDWSDFGDGSWIASVGWDESLYIWN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 56/220 (25%)
WD40 14..260 CDD:238121 52/210 (25%)
WD40 repeat 22..58 CDD:293791 10/47 (21%)
WD40 repeat 63..99 CDD:293791 11/38 (29%)
WD40 repeat 106..142 CDD:293791 9/36 (25%)
WD40 repeat 148..184 CDD:293791 13/28 (46%)
WD40 repeat 192..228 CDD:293791
WD40 repeat 285..310 CDD:293791
pex7NP_001343038.1 WD40 35..>306 CDD:225201 55/221 (25%)
WD40 repeat 65..101 CDD:293791 4/14 (29%)
WD40 repeat 106..143 CDD:293791 8/36 (22%)
WD40 repeat 151..185 CDD:293791 2/33 (6%)
WD40 repeat 192..230 CDD:293791 11/38 (29%)
WD40 repeat 236..273 CDD:293791 10/37 (27%)
WD40 repeat 279..305 CDD:293791 11/25 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.