| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001350671.1 | Gene: | ATG16L1 / 55054 | HGNCID: | 21498 | Length: | 624 | Species: | Homo sapiens |
| Alignment Length: | 295 | Identity: | 78/295 - (26%) |
|---|---|---|---|
| Similarity: | 124/295 - (42%) | Gaps: | 51/295 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 IYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFM--SLTGHNRSIDCVRFAYKDN 73
Fly 74 FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCI 138
Fly 139 K-VCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQI--MEFIADPPVTAITCVQFHPF 200
Fly 201 EFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRC------ITFSDNGECLFVGS-------- 251
Fly 252 ---------------SSGISVIGWEPDRELDHIKS 271 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 78/295 (26%) | ||
| WD40 | 14..260 | CDD:238121 | 73/279 (26%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 13/37 (35%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 14/36 (39%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 285..310 | CDD:293791 | |||
| ATG16L1 | NP_001350671.1 | ATG16 | 31..206 | CDD:312208 | |
| WD40 | <272..390 | CDD:225201 | 21/57 (37%) | ||
| WD40 | 332..622 | CDD:238121 | 78/295 (26%) | ||
| WD40 repeat | 344..381 | CDD:293791 | 13/36 (36%) | ||
| WD40 repeat | 387..423 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 428..465 | CDD:293791 | 15/37 (41%) | ||
| WD40 repeat | 473..503 | CDD:293791 | 6/31 (19%) | ||
| WD40 repeat | 508..544 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 554..590 | CDD:293791 | 5/35 (14%) | ||
| WD40 repeat | 597..621 | CDD:293791 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||