DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and wdr38

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001017672.1 Gene:wdr38 / 550366 ZFINID:ZDB-GENE-050417-160 Length:216 Species:Danio rerio


Alignment Length:186 Identity:47/186 - (25%)
Similarity:79/186 - (42%) Gaps:3/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSND 123
            |...::|..|:.....:.:..|.|.:..|..::.|:.::::||...|:...|:..|....|.|:|
Zfish    21 HKAEVNCCAFSPDCQLLLTCCDAGKLYLWKTSTAKLLASVSGHTGPVKCCVFSSDGRLFASASHD 85

  Fly   124 TTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPP 188
            .:||.| ..:...|......|...|.:|.|||||.|:.|.|.:...|||.|:....:.|..... 
Zfish    86 CSVRTW-CNSSLKCTHTLTAHRRSVETVSFSPDGQWLLSGGWDNRALIWSIQSGALLEELKGHN- 148

  Fly   189 VTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNG 244
             .|:....|......:|.|..|..|.::.|..:|..:.....:...:.|:.||..|
Zfish   149 -AAVQSSVFSSDSQSVATGSWDRAVRVWKLRDRQAEAVVLQGHLGNVACLCFSVAG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 47/186 (25%)
WD40 14..260 CDD:238121 47/186 (25%)
WD40 repeat 22..58 CDD:293791
WD40 repeat 63..99 CDD:293791 6/35 (17%)
WD40 repeat 106..142 CDD:293791 9/35 (26%)
WD40 repeat 148..184 CDD:293791 15/35 (43%)
WD40 repeat 192..228 CDD:293791 7/35 (20%)
WD40 repeat 285..310 CDD:293791
wdr38NP_001017672.1 WD40 <14..>208 CDD:225201 47/186 (25%)
WD40 <15..200 CDD:238121 44/181 (24%)
WD40 repeat 26..62 CDD:293791 6/35 (17%)
WD40 repeat 67..103 CDD:293791 10/36 (28%)
WD40 repeat 110..145 CDD:293791 14/34 (41%)
WD40 repeat 152..188 CDD:293791 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.