DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Plrg1

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_058064.2 Gene:Plrg1 / 53317 MGIID:1858197 Length:513 Species:Mus musculus


Alignment Length:403 Identity:83/403 - (20%)
Similarity:147/403 - (36%) Gaps:113/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIYD-IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73
            |:|. |..|...|..:.:....:..|||..||.:.:|.:...:..:|||||..::..|..:.:..
Mouse   194 KLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSP 258

  Fly    74 FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCI 138
            :::|..:...::.|||...|:....:||:.:|..||.:|:.:.:|:.|.|:|.|:|||:.:.: :
Mouse   259 YLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKAS-V 322

  Fly   139 KVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVT------AITCVQF 197
            ....||.:.|.:|:.......|.:...:.:|.:||:...|        ..||      ::..|..
Mouse   323 HTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGK--------TRVTLTNHKKSVRAVVL 379

  Fly   198 HPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEP 262
            ||..:..|:|..|.                       |:...|.|.|   |:.:.||.:.|    
Mouse   380 HPLLYTFASGSPDN-----------------------IKQWKFPDGG---FIQNLSGHNAI---- 414

  Fly   263 DRELDHIKSTWSSLADMKVVNNKLICGCHEIDTVSINTISLDRVIPFYQPPNSLPNFKHNSTNRK 327
                                          |:|:::|.   |.|         |.:...|.|...
Mouse   415 ------------------------------INTLAVNA---DGV---------LVSGADNGTMHL 437

  Fly   328 SFTRGNQKFRLSVGGAKPAQVQEEH-----------------EGDKSGLSSPNYSLEVVNEAVLE 375
            ...|....|:......:|..:..|.                 |.||        :::|..|....
Mouse   438 WDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAEADK--------TIKVYREDETA 494

  Fly   376 SAETSPMSSLPPV 388
            :.||.|:|..|.:
Mouse   495 TEETHPVSWKPEI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 69/326 (21%)
WD40 14..260 CDD:238121 59/251 (24%)
WD40 repeat 22..58 CDD:293791 8/35 (23%)
WD40 repeat 63..99 CDD:293791 6/35 (17%)
WD40 repeat 106..142 CDD:293791 11/35 (31%)
WD40 repeat 148..184 CDD:293791 7/35 (20%)
WD40 repeat 192..228 CDD:293791 6/35 (17%)
WD40 repeat 285..310 CDD:293791 5/24 (21%)
Plrg1NP_058064.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..160
WD40 <192..488 CDD:225201 76/382 (20%)
WD40 195..489 CDD:238121 76/382 (20%)
WD 1 201..240 8/38 (21%)
WD40 repeat 208..243 CDD:293791 8/34 (24%)
WD 2 243..282 8/38 (21%)
WD40 repeat 249..285 CDD:293791 6/35 (17%)
WD 3 285..324 14/39 (36%)
WD40 repeat 290..326 CDD:293791 12/36 (33%)
WD 4 327..366 9/46 (20%)
WD40 repeat 333..368 CDD:293791 8/42 (19%)
WD 5 369..409 11/65 (17%)
WD40 repeat 374..409 CDD:293791 11/60 (18%)
WD 6 410..448 12/83 (14%)
WD40 repeat 415..454 CDD:293791 10/50 (20%)
WD 7 459..498 6/46 (13%)
WD40 repeat 464..488 CDD:293791 3/31 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.