DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Spag16

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_038940027.1 Gene:Spag16 / 501158 RGDID:1565062 Length:641 Species:Rattus norvegicus


Alignment Length:228 Identity:72/228 - (31%)
Similarity:107/228 - (46%) Gaps:9/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSI-DCVRFAYKDNFVYSADDIGIIRRWDLNSQ 92
            :|..|.|...|..:.||.:.:.||.::..|||.:| .|...:..| ||.||......:.||:||:
  Rat   415 SGSKLATSSGDSTIKLWDLSKGECILTFAGHNHAIWSCTWHSCGD-FVASASLDMTSKIWDVNSE 478

  Fly    93 KIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDG 157
            :...||.||..||.:::|.|....:::.|.|.|:.:||.:. ..|.:...|||..||...|:|.|
  Rat   479 RCRYTLYGHTDSVNSIEFFPFSNTLLTASADKTLSVWDART-GKCEQSLYGHMHSVNDATFTPRG 542

  Fly   158 LWIASAGLEGSILIWDIRKSKQIMEFIADP-PVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQ 221
            ..:||....|.|.:||.||...|:.....| |...   |.|.|...:||....:|.:.:.||:..
  Rat   543 HILASCDSRGVIKLWDFRKLIPIVSIDVGPSPGNE---VNFDPSGRVLAQASANGIIHLLDLKSG 604

  Fly   222 QLVSQTTHFYGQAIRCITFSDNGECLFVGSSSG 254
            |:.....|  ...:..:.||...|.|:.|.|.|
  Rat   605 QIHKLVGH--ESEVHTVIFSHRAENLYSGGSDG 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 72/228 (32%)
WD40 14..260 CDD:238121 72/228 (32%)
WD40 repeat 22..58 CDD:293791 8/28 (29%)
WD40 repeat 63..99 CDD:293791 12/36 (33%)
WD40 repeat 106..142 CDD:293791 8/35 (23%)
WD40 repeat 148..184 CDD:293791 14/35 (40%)
WD40 repeat 192..228 CDD:293791 9/35 (26%)
WD40 repeat 285..310 CDD:293791
Spag16XP_038940027.1 WD40 354..640 CDD:238121 72/228 (32%)
WD40 repeat 365..402 CDD:293791
WD40 repeat 408..444 CDD:293791 8/28 (29%)
WD40 repeat 449..485 CDD:293791 12/36 (33%)
WD40 repeat 492..526 CDD:293791 8/34 (24%)
WD40 repeat 533..569 CDD:293791 14/35 (40%)
WD40 repeat 575..610 CDD:293791 9/37 (24%)
WD40 repeat 616..640 CDD:293791 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.