DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and zgc:86896

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001002100.1 Gene:zgc:86896 / 415190 ZFINID:ZDB-GENE-040625-80 Length:357 Species:Danio rerio


Alignment Length:245 Identity:53/245 - (21%)
Similarity:100/245 - (40%) Gaps:70/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAI--GQNECFMSLTGHNRSIDCVRFAYKD 72
            ||:::..|..|:|.:|.......:||...|||..:|.:  |..:..:.|...||:..||:::..:
Zfish    44 KIHELTEHSGRITGIDWAPESNRIVTCASDRNAYVWTLKDGVWKPTLVLVRINRAATCVKWSPLE 108

  Fly    73 NFVYSADDIGIIRRWDLNS-QKIYST----------LNGHMK-----SVRTLDFNPSGEYVVSGS 121
            |            ::.|.| .|:.|.          |:.|:|     :|.:||::|:...:.:||
Zfish   109 N------------KFALGSGAKLISICYFEKENDWWLSKHIKKPINSTVLSLDWHPNNMLLAAGS 161

  Fly   122 NDTTVRLW-----DVQNENNC---------------IKVCRGHMSHVNSVKFSPDGLWIASAGLE 166
            .|...|::     |:::....               .|.|.|   .|:||.|||.|..:|.....
Zfish   162 ADLHCRIFSAYIKDIEDRPGPTPWGSKMPFGELLLEYKECGG---WVHSVCFSPSGDSLAWVSHN 223

  Fly   167 GSILIWDIRKSKQIME------------FIADPPVTAI--TCVQFHPFEF 202
            .:|.:.|..:.|::.:            ::::..:.|.  .|.   |::|
Zfish   224 SAINVADASQGKEVTQLTTRHLPLLSVLYVSETEIVAAGHDCC---PYQF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 53/245 (22%)
WD40 14..260 CDD:238121 51/241 (21%)
WD40 repeat 22..58 CDD:293791 10/37 (27%)
WD40 repeat 63..99 CDD:293791 7/46 (15%)
WD40 repeat 106..142 CDD:293791 9/55 (16%)
WD40 repeat 148..184 CDD:293791 11/47 (23%)
WD40 repeat 192..228 CDD:293791 3/13 (23%)
WD40 repeat 285..310 CDD:293791
zgc:86896NP_001002100.1 WD40 <2..>241 CDD:225201 49/211 (23%)
WD40 repeat 11..50 CDD:293791 2/5 (40%)
WD40 45..>266 CDD:295369 49/235 (21%)
WD40 repeat 56..94 CDD:293791 10/37 (27%)
WD40 repeat 99..138 CDD:293791 9/50 (18%)
WD40 repeat 146..199 CDD:293791 8/52 (15%)
WD40 repeat 205..241 CDD:293791 11/35 (31%)
WD40 repeat 247..285 CDD:293791 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.