DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and CG14722

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_650111.3 Gene:CG14722 / 41419 FlyBaseID:FBgn0037943 Length:498 Species:Drosophila melanogaster


Alignment Length:331 Identity:68/331 - (20%)
Similarity:124/331 - (37%) Gaps:61/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDIKAHDSRVTSLDLGETGRVLVTGG-------EDRNVNLWAIGQN---ECFMSLTGHNRSIDCV 66
            :|..|.||......|.|.|.|...|.       :|.|.:    |.|   |....|...:.:.:.|
  Fly    76 FDPNAADSDSDDSMLDEAGGVTAGGATSAKKRKDDDNPS----GSNKQPEATFDLDEDDETDETV 136

  Fly    67 R--------------------------FAYKDNFVYSADDIGIIR--RWDLNSQKIYSTLNGHMK 103
            |                          |....:.:..|..||.:.  .:|..:.|:..|:..|.|
  Fly   137 RAMIAAIKKPRSSPPEIKLEDFITDICFHPDRDIIALATIIGDVHLYEYDNEANKLLRTIEVHSK 201

  Fly   104 SVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGS 168
            :.|.::|...|.::::.|.|..|.:.|::.|.........|...:|::....:.|: ||....|:
  Fly   202 ACRDVEFTEDGRFLLTCSKDKCVMVTDMETEKLKKLYETAHDDAINTLHVLNENLF-ASGDDAGT 265

  Fly   169 ILIWDIRKSKQIMEF--IADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFY 231
            :.:||:|....|.|.  :.|    .||.:..:....||.|...||.::.:::..:::..|:.. |
  Fly   266 VKLWDLRTKNAIFELKELED----QITQLTTNEQSKLLLATSADGYLTTFNISARKMYVQSEP-Y 325

  Fly   232 GQAIRCITFSDNGECLFVGSSSG-ISVIGW-EPDRELDHIKSTWSSLADMKVVNNKLIC------ 288
            .:.:.|:........|.||:|.| :....| :.....|......|.::.|..:.:::.|      
  Fly   326 EEELNCMGVYRGDSKLVVGTSKGRLYTYNWGQFGYHCDMYPGIKSPISLMIPITDRIACVAGEDG 390

  Fly   289 ---GCH 291
               .||
  Fly   391 NIRACH 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 68/331 (21%)
WD40 14..260 CDD:238121 60/286 (21%)
WD40 repeat 22..58 CDD:293791 11/45 (24%)
WD40 repeat 63..99 CDD:293791 9/63 (14%)
WD40 repeat 106..142 CDD:293791 8/35 (23%)
WD40 repeat 148..184 CDD:293791 10/37 (27%)
WD40 repeat 192..228 CDD:293791 8/35 (23%)
WD40 repeat 285..310 CDD:293791 3/16 (19%)
CG14722NP_650111.3 WD40 <156..459 CDD:225201 51/247 (21%)
WD40 156..438 CDD:295369 51/247 (21%)
WD40 repeat 160..198 CDD:293791 7/37 (19%)
WD40 repeat 203..239 CDD:293791 8/35 (23%)
WD40 repeat 247..284 CDD:293791 10/37 (27%)
WD40 repeat 287..354 CDD:293791 15/67 (22%)
WD40 repeat 367..406 CDD:293791 5/30 (17%)
WD40 repeat 413..437 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.