DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and CG3909

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:126/295 - (42%) Gaps:30/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVTGGEDRNVNLWAIGQNECFM---SLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKI 94
            |||||.|..|.:|.:.::....   .|.||...:..|..:.....:.|:.....:..||..|...
  Fly    55 LVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDK 119

  Fly    95 YSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLW 159
            ...|:.....:.|:.|:|..:||:||.||..:.::.|:.......:...:..:..|:.:||||.:
  Fly   120 KHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKY 184

  Fly   160 IASAGLEGSILIWDIRKSK--QIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQ 222
            |||..::|.|.|:|:...|  |.:|..|.|    :..:.|.|...||.....||.:.:||:.|..
  Fly   185 IASGAIDGIITIFDVAAGKVVQTLEGHAMP----VRSLCFSPNSQLLLTASDDGHMKLYDVTHSD 245

  Fly   223 LVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEPDRE------LDHIKSTWSSLADMKV 281
            :|. |...:...:.|:.||::|: .|..|||..||..|:....      .:|....|.....   
  Fly   246 VVG-TLSGHASWVLCVAFSEDGK-HFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYS--- 305

  Fly   282 VNNKLICGCHEIDTVSINTISLDRVIPFYQPPNSL 316
            ..|..:....|..:::|          :|.|||::
  Fly   306 PGNDKVASASEDKSLNI----------YYCPPNAI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 75/295 (25%)
WD40 14..260 CDD:238121 65/231 (28%)
WD40 repeat 22..58 CDD:293791 9/27 (33%)
WD40 repeat 63..99 CDD:293791 5/35 (14%)
WD40 repeat 106..142 CDD:293791 10/35 (29%)
WD40 repeat 148..184 CDD:293791 15/37 (41%)
WD40 repeat 192..228 CDD:293791 10/35 (29%)
WD40 repeat 285..310 CDD:293791 2/24 (8%)
CG3909NP_649969.1 WD40 52..323 CDD:238121 71/286 (25%)
WD40 <54..326 CDD:225201 72/289 (25%)
WD40 repeat 89..127 CDD:293791 6/37 (16%)
WD40 repeat 130..166 CDD:293791 10/35 (29%)
WD40 repeat 174..209 CDD:293791 14/34 (41%)
WD40 repeat 215..251 CDD:293791 11/36 (31%)
WD40 repeat 257..293 CDD:293791 11/36 (31%)
WD40 repeat 299..323 CDD:293791 4/36 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.