DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and CG7611

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001163489.1 Gene:CG7611 / 40386 FlyBaseID:FBgn0037094 Length:630 Species:Drosophila melanogaster


Alignment Length:248 Identity:61/248 - (24%)
Similarity:99/248 - (39%) Gaps:56/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 WDLNSQKIYSTLNGH--------MKSVRTL----------DFNPSGEYVVSGSNDTTVRLWDVQN 133
            |:.|.:.: |.|..|        |::::.|          .|:|.|..:.:||.|:||.:|||..
  Fly   282 WETNLETV-SLLTDHCCTTDGFPMQTIQILTDHCDEVWFCKFSPDGLKLATGSKDSTVIIWDVDP 345

  Fly   134 ENNCIK---VCRGHMS-HVNSVKFSPDGLWIASAGLEGS--ILIWDIRKSKQIMEF---IADPPV 189
            ....:|   |..|... .|:.|.:|||...|...|.|.|  :.||::...|.:::|   :.|   
  Fly   346 YKLTLKHRRVLDGQAQLSVSFVSWSPDSKLILVGGTEDSHELYIWNVDDGKLVVKFSQSLED--- 407

  Fly   190 TAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITF-SDNGECLFVGSSS 253
             ::.|..|.........|...|.:.:.||....:.|    :.|..:..|.| :||...|  .:.:
  Fly   408 -SLACGAFSRDGARFVCGGQKGQLYLCDLNGTIVDS----WEGVRVNSIAFRADNKTIL--AADN 465

  Fly   254 GISVIGWEPDRELDHIKSTWSSLADMKVVNNKLICGCHEIDTVSINTISLDRV 306
            ...:.|:..|          |..:|..::...     |.|.|.|||  |.||:
  Fly   466 HYRIRGYNFD----------SPRSDFDILREP-----HPIMTFSIN--SADRL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 61/248 (25%)
WD40 14..260 CDD:238121 48/200 (24%)
WD40 repeat 22..58 CDD:293791
WD40 repeat 63..99 CDD:293791 3/11 (27%)
WD40 repeat 106..142 CDD:293791 14/48 (29%)
WD40 repeat 148..184 CDD:293791 13/40 (33%)
WD40 repeat 192..228 CDD:293791 7/35 (20%)
WD40 repeat 285..310 CDD:293791 9/22 (41%)
CG7611NP_001163489.1 CTLH 129..190 CDD:128914
WD40 <303..605 CDD:225201 56/226 (25%)
WD40 307..602 CDD:295369 55/222 (25%)
WD40 repeat 318..358 CDD:293791 13/39 (33%)
WD40 repeat 364..402 CDD:293791 12/37 (32%)
WD40 repeat 410..444 CDD:293791 7/37 (19%)
WD40 repeat 448..534 CDD:293791 18/73 (25%)
WD40 repeat 577..602 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.