DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Poc1

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster


Alignment Length:309 Identity:73/309 - (23%)
Similarity:123/309 - (39%) Gaps:76/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDI 81
            |...:|.|..|..|..:.|...|..|.||.:.|....:....|:..::.|.::.|.|.|.||...
  Fly    17 HSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNLVASAGHD 81

  Fly    82 GIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDV---------QNENNC 137
            ..::.|:...:.:......|.|:||::||:.:|..:::.|:|.:.::|.|         ..:||.
  Fly    82 RTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNW 146

  Fly   138 IKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF---------IADPP----- 188
            ::          |.||||:|..:|:|..:.|:.|:|:...:.:..|         :|..|     
  Fly   147 VR----------SAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNML 201

  Fly   189 VTAITC--------------------------VQFHPFEFLLAAGRVDGTVSIYD-LEHQQLVSQ 226
            ..|:.|                          |.|||....|.:|..|.|:.|.| ||.:.:.:.
  Fly   202 AVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTL 266

  Fly   227 TTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEPDRELDHIKSTWSS 275
            |.|  ..|:..:.||.:|:....|.|          ||:|    ..|.|
  Fly   267 TGH--TDAVNAVAFSRDGDKFATGGS----------DRQL----LVWQS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 73/309 (24%)
WD40 14..260 CDD:238121 68/292 (23%)
WD40 repeat 22..58 CDD:293791 10/35 (29%)
WD40 repeat 63..99 CDD:293791 7/35 (20%)
WD40 repeat 106..142 CDD:293791 10/44 (23%)
WD40 repeat 148..184 CDD:293791 12/44 (27%)
WD40 repeat 192..228 CDD:293791 13/62 (21%)
WD40 repeat 285..310 CDD:293791
Poc1NP_001261799.1 WD40 10..298 CDD:238121 71/306 (23%)
WD40 14..388 CDD:225201 73/309 (24%)
WD40 repeat 22..58 CDD:293791 10/35 (29%)
WD40 repeat 63..99 CDD:293791 7/35 (20%)
WD40 repeat 106..140 CDD:293791 8/33 (24%)
WD40 repeat 147..183 CDD:293791 11/45 (24%)
WD40 repeat 189..224 CDD:293791 4/34 (12%)
WD40 repeat 231..254 CDD:293791 8/22 (36%)
WD40 repeat 273..297 CDD:293791 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.