| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_958502.1 | Gene: | pafah1b1a / 394246 | ZFINID: | ZDB-GENE-040116-2 | Length: | 410 | Species: | Danio rerio |
| Alignment Length: | 226 | Identity: | 57/226 - (25%) |
|---|---|---|---|
| Similarity: | 106/226 - (46%) | Gaps: | 21/226 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 YDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVY 76
Fly 77 SADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVC 141
Fly 142 RGHMSHVNSVKFSPDGLWIASAGLEGSILIW---------DIRKSKQIMEFIADPPVTAITCV-- 195
Fly 196 --------QFHPFEFLLAAGRVDGTVSIYDL 218 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 57/226 (25%) | ||
| WD40 | 14..260 | CDD:238121 | 56/224 (25%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 7/35 (20%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 10/44 (23%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 285..310 | CDD:293791 | |||
| pafah1b1a | NP_958502.1 | LisH | 9..35 | CDD:285685 | |
| WD40 | <100..410 | CDD:225201 | 57/226 (25%) | ||
| WD40 | 104..408 | CDD:238121 | 56/224 (25%) | ||
| WD 1 | 106..145 | 9/38 (24%) | |||
| WD40 repeat | 111..148 | CDD:293791 | 8/36 (22%) | ||
| WD 2 | 148..187 | 8/38 (21%) | |||
| WD40 repeat | 154..190 | CDD:293791 | 6/35 (17%) | ||
| WD 3 | 190..229 | 13/39 (33%) | |||
| WD40 repeat | 195..231 | CDD:293791 | 12/36 (33%) | ||
| WD 4 | 232..271 | 10/38 (26%) | |||
| WD40 repeat | 238..273 | CDD:293791 | 7/34 (21%) | ||
| WD 5 | 274..333 | 12/53 (23%) | |||
| WD40 repeat | 279..335 | CDD:293791 | 12/48 (25%) | ||
| WD 6 | 336..375 | ||||
| WD40 repeat | 341..377 | CDD:293791 | |||
| WD 7 | 378..410 | ||||
| WD40 repeat | 383..407 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||