DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Wdr88

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_036009101.1 Gene:Wdr88 / 384605 MGIID:2686275 Length:667 Species:Mus musculus


Alignment Length:372 Identity:73/372 - (19%)
Similarity:136/372 - (36%) Gaps:74/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLISKIYD--IKAHDSR---------------VTSLDLGETGRVLVTGGEDRNVNLWAIGQNECF 53
            :.:|..||  :|..|:.               |....:....|.:|....|:.|..|.:...:..
Mouse   303 RFLSSSYDCSVKLWDAEDGTVIWDFEPRPKAPVLECSITADNRRIVASSYDKTVRAWDVETGQLL 367

  Fly    54 MSLTGHNRSIDCVRFAYKDNFVYSADDI--GIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEY 116
            ..:. |:..:.|.:|:....||.||.|:  ||......|...:....:.|.:|:.:..|:|..:.
Mouse   368 WKVR-HDTFVVCCKFSPNGKFVLSALDVDRGIYLMDPENITTVIHMKDHHQRSITSCCFDPDSQK 431

  Fly   117 VVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDI-----RK 176
            |.|.|.|..:::||:.:......:.:.|.:.::...|:..|.::.::..:.:|.||::     |.
Mouse   432 VASVSMDRCIKIWDITSRTTLFTIPKAHYNAISDCCFTSTGHFLCTSSWDKNIKIWNVHTGEFRN 496

  Fly   177 SKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDL----------EHQQLVSQTTHFY 231
            ....:..:........:|.......||::.| .|.||:|:|:          .|:..|:.     
Mouse   497 RGACVTLMKGHEGCVSSCCIARDSSFLISGG-FDKTVAIWDVGGGYRKLALKGHEDWVTD----- 555

  Fly   232 GQAIRCITFSDNGECLFVGSSS-----------GISVIGWEPDRELDH--IKSTWSSLADMKVVN 283
                  :..|:|.:.:...|..           .:|:.||....:|.|  :...|.||.......
Mouse   556 ------VAISNNKKWILSASKEPPGNMALSPLFHLSIWGWPGGSDLYHECLSFCWRSLTRQWHSR 614

  Fly   284 NKLICGCHEIDTVSINTISLDRVIPFYQPPNSLPNFK--HNSTNRKS 328
            ...:.|.|::      |....|      ||.:...|.  |||..|.|
Mouse   615 QPALQGKHQL------TAKQPR------PPEAPDGFLPFHNSHLRTS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 73/372 (20%)
WD40 14..260 CDD:238121 51/288 (18%)
WD40 repeat 22..58 CDD:293791 5/35 (14%)
WD40 repeat 63..99 CDD:293791 10/37 (27%)
WD40 repeat 106..142 CDD:293791 8/35 (23%)
WD40 repeat 148..184 CDD:293791 6/40 (15%)
WD40 repeat 192..228 CDD:293791 11/45 (24%)
WD40 repeat 285..310 CDD:293791 4/24 (17%)
Wdr88XP_036009101.1 WD40 281..569 CDD:238121 52/278 (19%)
WD40 repeat 292..330 CDD:293791 5/26 (19%)
WD40 repeat 336..371 CDD:293791 5/34 (15%)
WD40 repeat 376..413 CDD:293791 10/36 (28%)
WD40 repeat 421..456 CDD:293791 8/34 (24%)
WD40 repeat 463..505 CDD:293791 6/41 (15%)
WD40 repeat 511..537 CDD:293791 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.