DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Cdc40

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001381149.1 Gene:Cdc40 / 361859 RGDID:1307063 Length:579 Species:Rattus norvegicus


Alignment Length:255 Identity:66/255 - (25%)
Similarity:108/255 - (42%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GHNRSIDCVRFAYK---DNFVYSADDIGIIRRWDLNSQKIY------STLNGHMKSVRTLDFNP- 112
            |..::|..|:..|.   .::::...|:|:..|..:..:|.|      ...:||.|.|..:...| 
  Rat   235 GEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSSVPPEKCYLPKKQIHVWSGHTKGVSAVRLFPL 299

  Fly   113 SGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKS 177
            ||..::|.|.|..::||:|..:..|::...||...|..:.|:..|....||..:..:.:||....
  Rat   300 SGHLLLSCSMDCKIKLWEVYGDRRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETG 364

  Fly   178 KQIMEFI-ADPPVTAITCVQFHPFE---FLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCI 238
            :.|..|. ...|.    ||:|:|.|   .|..||..|..:..:|:...::|.:.....| |:..|
  Rat   365 QCISRFTNRKVPY----CVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLG-AVNTI 424

  Fly   239 TFSDNGECLFVGSSSGISVIGWEPDRELDHIKSTWSSLADMKVV----NNKLICGCHEID 294
            .|.|... .||.:|...|:..||.|..:|.......|:..|..|    |.|.: .|..:|
  Rat   425 VFVDENR-RFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWL-ACQSMD 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 66/255 (26%)
WD40 14..260 CDD:238121 55/215 (26%)
WD40 repeat 22..58 CDD:293791 66/255 (26%)
WD40 repeat 63..99 CDD:293791 8/44 (18%)
WD40 repeat 106..142 CDD:293791 10/36 (28%)
WD40 repeat 148..184 CDD:293791 8/35 (23%)
WD40 repeat 192..228 CDD:293791 11/38 (29%)
WD40 repeat 285..310 CDD:293791 3/10 (30%)
Cdc40NP_001381149.1 WD40 281..579 CDD:238121 57/209 (27%)
WD40 repeat 292..330 CDD:293791 10/37 (27%)
WD40 repeat 335..371 CDD:293791 8/35 (23%)
WD40 repeat 377..415 CDD:293791 11/41 (27%)
WD40 repeat 421..503 CDD:293791 18/64 (28%)
WD40 repeat 511..547 CDD:293791
WD40 repeat 553..578 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.