DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and katnbl1

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001006019.1 Gene:katnbl1 / 325430 ZFINID:ZDB-GENE-030131-4155 Length:305 Species:Danio rerio


Alignment Length:333 Identity:55/333 - (16%)
Similarity:117/333 - (35%) Gaps:104/333 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 LDKNEEADVQQLEFNLNDSNPPILNNYDNYEMAEDFPVNQNLNYITNNYKPV---PATSTINASS 522
            |...:|.:::::::.|.|...           .|.|||.:.::..:...:.|   ..|.......
Zfish    29 LCSGDEKNMREVDYLLKDETD-----------QERFPVGRCVHKYSKTKREVVGKKKTRLSGVGP 82

  Fly   523 KSIKKTTTTTLHKRTTNNMAGAKQTSTGIFGGSKLSQVSSVSSMELHKLDDNMVLKKSSSSNVVN 587
            ::.:|..||:    .|::||            :|.::::.|..::.....||....       ||
Zfish    83 RACRKLPTTS----RTSDMA------------NKENELTCVDEVQAFLYSDNCGFP-------VN 124

  Fly   588 KNKRPMGSAQSQFSKENNQQKNINVEIITKPPMRSRTTLDMRTSHQAKTQEKQIHQQQPMNNRII 652
            .....|..|.|::|                                                   
Zfish   125 STDAKMAGAGSKYS--------------------------------------------------- 138

  Fly   653 MDDHDFDMLSRSHEAVLQELSNRQSSLDLLRHATRSH--DVLGALRQARSCGKSIFIDLLGAIL- 714
              |: |..||:.|||:...|..|...|::.....|.:  :::..|.:.:..|  :.:|.|..:. 
Zfish   139 --DY-FTELSKDHEAMSHVLFGRNLRLNVALTLWRKNASELVAYLNRIQDTG--VLVDCLPVLTK 198

  Fly   715 ----EKPSSWNLDFCMFVLPEIYELLQSQHKFHFTRACDTLRIILSNF---LPTIQENLDSWAAN 772
                |:|.. :|..|:.:.|::..:|.::::.|...|...::.|:..:   |.|..::|...::|
Zfish   199 SLQGEQPCI-SLGCCVDLFPQVKMILNTKYEEHLIVALHWVQSIIKKWWSELSTNNKSLPESSSN 262

  Fly   773 GLGVDVTR 780
            ...|...:
Zfish   263 DRNVQAMK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636 23/124 (19%)
WD40 <4..330 CDD:225201
WD40 14..260 CDD:238121
WD40 repeat 22..58 CDD:293791
WD40 repeat 63..99 CDD:293791
WD40 repeat 106..142 CDD:293791
WD40 repeat 148..184 CDD:293791
WD40 repeat 192..228 CDD:293791
WD40 repeat 285..310 CDD:293791
katnbl1NP_001006019.1 Katanin_con80 150..298 CDD:290636 23/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.