| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101117.1 | Gene: | Utp15 / 310019 | RGDID: | 1310992 | Length: | 528 | Species: | Rattus norvegicus |
| Alignment Length: | 233 | Identity: | 69/233 - (29%) |
|---|---|---|---|
| Similarity: | 108/233 - (46%) | Gaps: | 15/233 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 ETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRF-AYKDNFVYSADDIGIIRRWDLNS 91
Fly 92 QKIYSTLNGHMKSVR---TLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKF 153
Fly 154 SPDGLWIASAGLEGS-ILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYD 217
Fly 218 LEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGI 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 69/233 (30%) | ||
| WD40 | 14..260 | CDD:238121 | 69/233 (30%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 9/29 (31%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 12/36 (33%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 11/38 (29%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 13/36 (36%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 285..310 | CDD:293791 | |||
| Utp15 | NP_001101117.1 | WD 1. /evidence=ECO:0000255 | 36..75 | ||
| WD40 | 39..298 | CDD:238121 | 63/217 (29%) | ||
| WD40 repeat | 41..78 | CDD:293791 | |||
| WD 2. /evidence=ECO:0000255 | 78..117 | 9/26 (35%) | |||
| WD40 repeat | 84..120 | CDD:293791 | 9/29 (31%) | ||
| WD 3. /evidence=ECO:0000255 | 120..159 | 13/39 (33%) | |||
| WD40 repeat | 125..161 | CDD:293791 | 12/36 (33%) | ||
| WD 4. /evidence=ECO:0000255 | 162..202 | 13/43 (30%) | |||
| WD40 repeat | 169..202 | CDD:293791 | 10/36 (28%) | ||
| WD 5. /evidence=ECO:0000255 | 204..242 | 14/39 (36%) | |||
| WD40 repeat | 209..245 | CDD:293791 | 13/37 (35%) | ||
| WD 6. /evidence=ECO:0000255 | 246..285 | 10/41 (24%) | |||
| WD40 repeat | 251..277 | CDD:293791 | 8/25 (32%) | ||
| WD 7. /evidence=ECO:0000255 | 287..326 | 8/26 (31%) | |||
| WD40 repeat | 292..327 | CDD:293791 | 7/21 (33%) | ||
| UTP15_C | 344..490 | CDD:401366 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 508..528 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0267 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||