DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Tle6

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_006241089.2 Gene:Tle6 / 299637 RGDID:1561530 Length:546 Species:Rattus norvegicus


Alignment Length:237 Identity:46/237 - (19%)
Similarity:80/237 - (33%) Gaps:48/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGETGRVLVTGGED-RNVNLWAIGQNECFMSLTGHNRSIDCVRFA-YKDNFVYSADDIGIIRRWD 88
            |....|.|..||.: ..|.:|.:.....:.........:.|...| .|:|.|::....|.:|.||
  Rat   316 LSSNSRTLFAGGYNLPGVFVWDLAARSLYEKYQLPCDGLSCQALASTKENMVFAGFTDGTVRIWD 380

  Fly    89 LNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQ--------------------- 132
            |.:|:|...||....:.:.|.......::  |..|..:|.||::                     
  Rat   381 LRTQEIVRDLNSPAGAAKCLVIKDDSVWM--GGLDACLRCWDLRVAKMSLEYPVQSQIMSLSHSV 443

  Fly   133 -------------------NENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSK 178
                               .|.|.:.........:..:.|||:|.|..|.|::..|.:..:....
  Rat   444 TEDWLLLGLADGQHCLFNSRERNQVLTVGTKDQTILRLSFSPNGQWWVSVGMDNLITVHSMPMGA 508

  Fly   179 QIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEH 220
            ::.:.   |...|:.|........|:..|..| ..|||.:::
  Rat   509 KLFQV---PEAAAVRCFDITENSRLIVTGSGD-CASIYHIKY 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 46/237 (19%)
WD40 14..260 CDD:238121 46/237 (19%)
WD40 repeat 22..58 CDD:293791 7/32 (22%)
WD40 repeat 63..99 CDD:293791 12/36 (33%)
WD40 repeat 106..142 CDD:293791 8/75 (11%)
WD40 repeat 148..184 CDD:293791 8/35 (23%)
WD40 repeat 192..228 CDD:293791 7/29 (24%)
WD40 repeat 285..310 CDD:293791
Tle6XP_006241089.2 WD40 251..538 CDD:421866 43/227 (19%)
WD40 repeat 252..306 CDD:293791
WD40 repeat 311..348 CDD:293791 7/31 (23%)
WD40 repeat 355..391 CDD:293791 12/35 (34%)
WD40 repeat 398..429 CDD:293791 6/32 (19%)
WD40 repeat 436..470 CDD:293791 2/33 (6%)
WD40 repeat 478..501 CDD:293791 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.