Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_758440.1 | Gene: | POC1B / 282809 | HGNCID: | 30836 | Length: | 478 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 74/262 - (28%) |
---|---|---|---|
Similarity: | 119/262 - (45%) | Gaps: | 5/262 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 SKIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73
Fly 74 FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCI 138
Fly 139 KVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFL 203
Fly 204 LAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEPDRELDH 268
Fly 269 IK 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
WD40 | <4..330 | CDD:225201 | 74/262 (28%) | ||
WD40 | 14..260 | CDD:238121 | 70/245 (29%) | ||
WD40 repeat | 22..58 | CDD:293791 | 10/35 (29%) | ||
WD40 repeat | 63..99 | CDD:293791 | 7/35 (20%) | ||
WD40 repeat | 106..142 | CDD:293791 | 13/35 (37%) | ||
WD40 repeat | 148..184 | CDD:293791 | 14/35 (40%) | ||
WD40 repeat | 192..228 | CDD:293791 | 12/35 (34%) | ||
WD40 repeat | 285..310 | CDD:293791 | |||
POC1B | NP_758440.1 | WD40 | 10..298 | CDD:238121 | 71/251 (28%) |
WD 1 | 16..55 | 0/3 (0%) | |||
WD40 repeat | 21..58 | CDD:293791 | 1/6 (17%) | ||
WD 2 | 58..99 | 12/40 (30%) | |||
WD40 repeat | 63..100 | CDD:293791 | 11/36 (31%) | ||
WD 3 | 101..139 | 8/37 (22%) | |||
WD40 repeat | 106..142 | CDD:293791 | 8/35 (23%) | ||
WD 4 | 142..181 | 15/39 (38%) | |||
WD40 repeat | 147..182 | CDD:293791 | 14/35 (40%) | ||
WD 5 | 183..223 | 14/39 (36%) | |||
WD40 repeat | 190..225 | CDD:293791 | 14/34 (41%) | ||
WD 6 | 226..265 | 12/41 (29%) | |||
WD40 repeat | 231..267 | CDD:293791 | 13/36 (36%) | ||
WD 7 | 268..307 | 9/39 (23%) | |||
WD40 repeat | 273..299 | CDD:293791 | 8/26 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |