DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Y111B2A.12

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001255175.1 Gene:Y111B2A.12 / 176680 WormBaseID:WBGene00013735 Length:417 Species:Caenorhabditis elegans


Alignment Length:216 Identity:47/216 - (21%)
Similarity:96/216 - (44%) Gaps:9/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPRKLI-SKIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSL-TGHNRSIDC 65
            :|.::| ..:..::||.....::.|. :.|.|.|||||....|:...|:|....| ..|..|:..
 Worm    42 VPAEIIDDSLMSLQAHAQDCFTVALA-SNRWLATGGEDDVAFLFDQNQSESEPVLKVEHKDSVTQ 105

  Fly    66 VRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWD 130
            |.|.:.:..:.:.|..|.|...::.::|:.:.:: ....:..:.::.:.:.:.:|..|..:.:|.
 Worm   106 VMFNHSETLLATGDLSGKIMISEMATKKVRAEID-ECNDLEWMCWHQTADILFAGDKDGILWMWL 169

  Fly   131 VQNENNC-IKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITC 194
            :.|:... .||..|:.|...:....|||..|.....:|.:.:|.:|:......:...|    ||.
 Worm   170 IGNKGIAQSKVYAGNGSSCTTGCLMPDGKRIMCGYSDGIVRLWLLREETSTHLYFHSP----ITA 230

  Fly   195 VQFHPFEFLLAAGRVDGTVSI 215
            :..|..:.:...|...|||::
 Worm   231 IDHHVTQTVAIIGTQSGTVNV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 47/215 (22%)
WD40 14..260 CDD:238121 45/204 (22%)
WD40 repeat 22..58 CDD:293791 12/36 (33%)
WD40 repeat 63..99 CDD:293791 6/35 (17%)
WD40 repeat 106..142 CDD:293791 6/36 (17%)
WD40 repeat 148..184 CDD:293791 7/35 (20%)
WD40 repeat 192..228 CDD:293791 7/24 (29%)
WD40 repeat 285..310 CDD:293791
Y111B2A.12NP_001255175.1 WD40 54..372 CDD:392136 45/204 (22%)
WD40 repeat 104..139 CDD:293791 6/34 (18%)
WD40 repeat 144..182 CDD:293791 6/37 (16%)
WD40 repeat 189..231 CDD:293791 10/45 (22%)
WD40 repeat 238..294 CDD:293791 4/14 (29%)
WD40 repeat 302..338 CDD:293791
WD40 repeat 345..371 CDD:293791
WD40 repeat 389..416 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.