| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_849143.1 | Gene: | DAW1 / 164781 | HGNCID: | 26383 | Length: | 415 | Species: | Homo sapiens |
| Alignment Length: | 295 | Identity: | 75/295 - (25%) |
|---|---|---|---|
| Similarity: | 117/295 - (39%) | Gaps: | 56/295 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRF--AYKDNFVY 76
Fly 77 SADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVC 141
Fly 142 RGHMSHVNSVKFSPDG-------------LWIASAGLEGSILI---------------------- 171
Fly 172 -------WDIRKSKQIMEFIADPPVTAITCVQFHPFEF---LLAAGRVDGTVSIYDLEHQQLVSQ 226
Fly 227 TTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWE 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 75/295 (25%) | ||
| WD40 | 14..260 | CDD:238121 | 74/292 (25%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 15/35 (43%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 12/77 (16%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 8/38 (21%) | ||
| WD40 repeat | 285..310 | CDD:293791 | |||
| DAW1 | NP_849143.1 | eRF1 | <22..>90 | CDD:224420 | 0/1 (0%) |
| WD40 | 81..120 | CDD:197651 | 11/31 (35%) | ||
| WD 1 | 90..129 | 12/38 (32%) | |||
| WD40 repeat | 96..132 | CDD:293791 | 11/35 (31%) | ||
| WD40 | 126..415 | CDD:238121 | 62/257 (24%) | ||
| WD 2 | 132..174 | 10/42 (24%) | |||
| WD40 repeat | 137..175 | CDD:293791 | 8/38 (21%) | ||
| WD 3 | 175..214 | 17/39 (44%) | |||
| WD40 repeat | 181..217 | CDD:293791 | 15/36 (42%) | ||
| WD 4 | 217..256 | 8/38 (21%) | |||
| WD40 repeat | 222..258 | CDD:293791 | 7/35 (20%) | ||
| WD 5 | 259..298 | 3/38 (8%) | |||
| WD40 repeat | 265..300 | CDD:293791 | 3/34 (9%) | ||
| WD 6 | 301..340 | 8/43 (19%) | |||
| WD40 repeat | 306..342 | CDD:293791 | 8/40 (20%) | ||
| WD 7 | 343..384 | 11/33 (33%) | |||
| WD40 repeat | 348..384 | CDD:293791 | 10/27 (37%) | ||
| WD 8 | 386..415 | ||||
| WD40 repeat | 390..414 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||