DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment kat80 and AgaP_AGAP001146

DIOPT Version :9

Sequence 1:	NP_523363.2	Gene:	kat80 / 32581	FlyBaseID:	FBgn0040207	Length:	819	Species:	Drosophila melanogaster
Sequence 2:	XP_322015.3	Gene:	AgaP_AGAP001146 / 1282020	VectorBaseID:	AGAP001146	Length:	911	Species:	Anopheles gambiae

Alignment Length:	137	Identity:	43/137 - (31%)
Similarity:	71/137 - (51%)	Gaps:	13/137 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 KIY-DIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73
            |.| .:..|...|.::|:.....:::||..||.:.:|.:...:|..||..|:.::..|:|....:
Mosquito   560 KFYLSLYGHKLPVVTMDISYDSTLIITGSADRTIKIWGMDFGDCHRSLLAHDNTVTAVQFIPNTH 624

  Fly    74 FVYSADDIGIIRRWDLNS-QKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLW-------- 129
            ..:|....|.:::||.:| |||. ||.||:.....|..:|:|:||||..:|.|:||:
Mosquito   625 MFFSCAKDGKLKQWDADSFQKII-TLPGHLGEAHALAISPNGKYVVSCGSDRTLRLFHRTEEPLV 688

  Fly   130 --DVQNE 134
              |||.|
Mosquito   689 LQDVQEE 695

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
kat80	NP_523363.2	Katanin_con80	667..803	CDD:290636
		WD40	<4..330	CDD:225201	43/137 (31%)
		WD40	14..260	CDD:238121	41/132 (31%)
		WD40 repeat	22..58	CDD:293791	9/35 (26%)
		WD40 repeat	63..99	CDD:293791	11/36 (31%)
		WD40 repeat	106..142	CDD:293791	15/39 (38%)
		WD40 repeat	148..184	CDD:293791
		WD40 repeat	192..228	CDD:293791
		WD40 repeat	285..310	CDD:293791
AgaP_AGAP001146	XP_322015.3	WD40	3..440	CDD:225201
		WD40 repeat	26..63	CDD:293791
		WD40	33..>221	CDD:295369
		WD40 repeat	69..105	CDD:293791
		WD40 repeat	110..146	CDD:293791
		WD40 repeat	153..188	CDD:293791
		WD40 repeat	195..236	CDD:293791
		WD40	<336..690	CDD:225201	39/130 (30%)
		WD40	387..680	CDD:238121	38/120 (32%)
		WD40 repeat	434..470	CDD:293791
		WD40 repeat	475..523	CDD:293791
		WD40 repeat	531..566	CDD:293791	2/5 (40%)
		WD40 repeat	573..608	CDD:293791	8/34 (24%)
		WD40 repeat	614..650	CDD:293791	11/36 (31%)
		WD40 repeat	657..680	CDD:293791	10/22 (45%)
		Utp12	768..869	CDD:281932
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910