DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and AgaP_AGAP006264

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_001688840.1 Gene:AgaP_AGAP006264 / 1276918 VectorBaseID:AGAP006264 Length:321 Species:Anopheles gambiae


Alignment Length:182 Identity:45/182 - (24%)
Similarity:86/182 - (47%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKIYDIKAHDSRVTSLDLGET--GRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSI-DCVRFAY 70
            |.:|  :.|...:.|:|..:.  .::.::...|..|.:|...:|....:..||.:.: ..|..|:
Mosquito   101 SMVY--REHKKEIYSVDWSKVPYEQLFISASWDSTVKIWDPIRNNSLSTYIGHTQLVYSAVFAAH 163

  Fly    71 KDNFVYSADDIGIIRRWDLNSQKI-YSTLNGHMKSVRTLDF-NPSGEYVVSGSNDTTVRLWDVQN 133
            ..|...|....|.::.||:....: .:::..|...|.|:|: ......:.:|::|..:|:||::|
Mosquito   164 IPNTFASVSGDGFLKIWDILCYDLPIASIKAHDGEVLTVDWCKHDSNILATGASDGLIRIWDLRN 228

  Fly   134 ENNCIKVCRGHMSHVNSVKFSPDGLWI-ASAGLEGSILIWDIRKSKQIMEFI 184
            ....|...:|:...|..|:|||....: ||.|.:.:..|||.:||.:.:|.|
Mosquito   229 FGVPITELKGNEFAVRKVQFSPHNFSVLASVGYDFTTRIWDFKKSNEAIETI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 45/182 (25%)
WD40 14..260 CDD:238121 43/177 (24%)
WD40 repeat 22..58 CDD:293791 6/37 (16%)
WD40 repeat 63..99 CDD:293791 7/37 (19%)
WD40 repeat 106..142 CDD:293791 9/36 (25%)
WD40 repeat 148..184 CDD:293791 14/36 (39%)
WD40 repeat 192..228 CDD:293791
WD40 repeat 285..310 CDD:293791
AgaP_AGAP006264XP_001688840.1 WD40 6..>313 CDD:225201 45/182 (25%)
WD40 repeat 12..58 CDD:293791
WD40 61..313 CDD:295369 45/182 (25%)
WD40 repeat 64..106 CDD:293791 2/6 (33%)
WD40 repeat 112..150 CDD:293791 6/37 (16%)
WD40 repeat 155..192 CDD:293791 7/36 (19%)
WD40 repeat 200..237 CDD:293791 9/36 (25%)
WD40 repeat 243..281 CDD:293791 15/38 (39%)
WD40 repeat 287..314 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.