DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and AgaP_AGAP012525

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_312729.4 Gene:AgaP_AGAP012525 / 1273722 VectorBaseID:AGAP012525 Length:303 Species:Anopheles gambiae


Alignment Length:231 Identity:65/231 - (28%)
Similarity:107/231 - (46%) Gaps:12/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TGRVLVTGGEDRNVNLWAIGQNECFMS----LTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDL 89
            :|.::..||.|..|.::.|...|...|    :..|...:.|..|...|..:.:.........||:
Mosquito    70 SGNLVACGGLDNKVTVYPITLEEDISSRKKTVGTHTSYMSCCIFPNSDQQILTGSGDSTCALWDV 134

  Fly    90 NSQKIYSTLNGHMKSVRTLDF--NPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVK 152
            .|.::..:.:||...|.::|.  |.:|...||||.|....:||::: .:.::...||.|.:||||
Mosquito   135 ESGQLLQSFHGHTGDVMSIDLAPNETGNTFVSGSCDKMAFIWDMRS-GHVVQSFEGHQSDINSVK 198

  Fly   153 FSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYD 217
            |.|.|..|::...:.:..::|:|..|::..|..|..:..:.||.|.....||.||..|.||:::|
Mosquito   199 FHPSGDAISTGSDDSTCRLFDMRADKEVAVFCKDSIIFGVNCVDFSVSGRLLFAGYNDYTVNVWD 263

  Fly   218 LEHQQLVSQTTHFYG--QAIRCITFSDNGECLFVGS 251
            ....|.|..   .||  ..:.|:..|.:|..|..||
Mosquito   264 TLKAQRVCL---LYGHENKVSCLQVSPDGTALSTGS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 65/231 (28%)
WD40 14..260 CDD:238121 65/231 (28%)
WD40 repeat 22..58 CDD:293791 8/32 (25%)
WD40 repeat 63..99 CDD:293791 6/35 (17%)
WD40 repeat 106..142 CDD:293791 10/37 (27%)
WD40 repeat 148..184 CDD:293791 11/35 (31%)
WD40 repeat 192..228 CDD:293791 13/35 (37%)
WD40 repeat 285..310 CDD:293791
AgaP_AGAP012525XP_312729.4 WD40 <6..303 CDD:225201 65/231 (28%)
WD40 9..303 CDD:238121 65/231 (28%)
WD40 repeat 20..57 CDD:293791
WD40 repeat 63..102 CDD:293791 8/31 (26%)
WD40 repeat 107..144 CDD:293791 6/36 (17%)
WD40 repeat 151..188 CDD:293791 10/37 (27%)
WD40 repeat 194..230 CDD:293791 11/35 (31%)
WD40 repeat 238..275 CDD:293791 13/39 (33%)
WD40 repeat 280..303 CDD:293791 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.