DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and AgaP_AGAP009506

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_310190.3 Gene:AgaP_AGAP009506 / 1271405 VectorBaseID:AGAP009506 Length:350 Species:Anopheles gambiae


Alignment Length:219 Identity:59/219 - (26%)
Similarity:105/219 - (47%) Gaps:11/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKIYDIKAHDSRVTSLDLGETG-RVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKD 72
            ::|..:|.|...|.|......| .::|:|.:|.::.:|. .:....:|...:...:..|.|....
Mosquito   134 TRIRKLKGHTHFVNSCSGARRGPTLIVSGSDDASIKIWD-ARKRHVVSTFDNTYQVTAVCFNDTA 197

  Fly    73 NFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQ---NE 134
            ..|.|......|:.||:..::|...|.||..:|..|..:|.|.||:|.|.|.|:|:||::   ..
Mosquito   198 EQVVSGGIDNEIKVWDIRKKEILYRLRGHTDTVTGLSLSPDGSYVLSNSMDNTLRIWDIRPYVPA 262

  Fly   135 NNCIKVCRGHMSHVNS----VKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCV 195
            ..|:||..||..:...    ..:|||||.|::...:..:.||| ..|::|: :.......::..:
Mosquito   263 ERCVKVFTGHQHNFEKNLLRCAWSPDGLKISAGSADRFVYIWD-TTSRRIL-YKLPGHNGSVNDI 325

  Fly   196 QFHPFEFLLAAGRVDGTVSIYDLE 219
            .|||.|.::.:|..|.|:.:.::|
Mosquito   326 DFHPTEPIIVSGSSDKTLYLGEIE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 59/219 (27%)
WD40 14..260 CDD:238121 58/214 (27%)
WD40 repeat 22..58 CDD:293791 7/36 (19%)
WD40 repeat 63..99 CDD:293791 8/35 (23%)
WD40 repeat 106..142 CDD:293791 15/38 (39%)
WD40 repeat 148..184 CDD:293791 11/39 (28%)
WD40 repeat 192..228 CDD:293791 8/28 (29%)
WD40 repeat 285..310 CDD:293791
AgaP_AGAP009506XP_310190.3 WD40 52..>345 CDD:225201 58/213 (27%)
WD40 54..345 CDD:238121 58/213 (27%)
WD40 repeat 61..99 CDD:293791
WD40 repeat 105..141 CDD:293791 1/6 (17%)
WD40 repeat 146..183 CDD:293791 8/37 (22%)
WD40 repeat 189..224 CDD:293791 8/34 (24%)
WD40 repeat 230..270 CDD:293791 16/39 (41%)
WD40 repeat 280..316 CDD:293791 11/37 (30%)
WD40 repeat 322..345 CDD:293791 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.