DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and WDFY2

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_443182.1 Gene:WDFY2 / 115825 HGNCID:20482 Length:400 Species:Homo sapiens


Alignment Length:177 Identity:45/177 - (25%)
Similarity:83/177 - (46%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISKIYDIKAHDSRVTS-LDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRS--IDCVRFA 69
            ::.:.:.:||.||||. |.:.|...||.| |:|:.   :|...:|....|.|:..|  ...::|.
Human   104 MTPVKNYQAHQSRVTMILFVLELEWVLST-GQDKQ---FAWHCSESGQRLGGYRTSAVASGLQFD 164

  Fly    70 YKDNFVYSADDIGIIRRWDLNSQK--IYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQ 132
            .:...|:..|..|.:....|..:.  :.:|..||...|..|.::|....:.|||:|.:|.:||:.
Human   165 VETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIG 229

  Fly   133 NENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQ 179
            .........:||...|.::.::.....:.|.|.:|.|::|::...:|
Human   230 GRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQ 276

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 45/177 (25%)
WD40 14..260 CDD:238121 45/171 (26%)
WD40 repeat 22..58 CDD:293791 11/36 (31%)
WD40 repeat 63..99 CDD:293791 6/37 (16%)
WD40 repeat 106..142 CDD:293791 9/35 (26%)
WD40 repeat 148..184 CDD:293791 7/32 (22%)
WD40 repeat 192..228 CDD:293791
WD40 repeat 285..310 CDD:293791
WDFY2NP_443182.1 WD40 16..272 CDD:330360 44/171 (26%)
WD 1 22..61
WD40 repeat 27..64 CDD:293791