| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598776.1 | Gene: | Fbxw11 / 103583 | MGIID: | 2144023 | Length: | 563 | Species: | Mus musculus |
| Alignment Length: | 283 | Identity: | 74/283 - (26%) |
|---|---|---|---|
| Similarity: | 114/283 - (40%) | Gaps: | 87/283 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 KLISKIYD--IKAHDSRVTSLD-----LGETG---------RVLVTGGEDRNVNLWAIGQNECFM 54
Fly 55 SLTGHNRSIDCVRFA-----------------------------------------YKDNFVYSA 78
Fly 79 DDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNCIKVCRG 143
Fly 144 HMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAIT-C------------- 194
Fly 195 VQFHPFEFLLAAGRVDGTVSIYD 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 74/283 (26%) | ||
| WD40 | 14..260 | CDD:238121 | 70/273 (26%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 15/49 (31%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 8/76 (11%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 14/35 (40%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 10/40 (25%) | ||
| WD40 repeat | 285..310 | CDD:293791 | |||
| Fbxw11 | NP_598776.1 | Beta-TrCP_D | 99..137 | CDD:403372 | |
| F-box-like | 141..188 | CDD:403981 | |||
| WD40 | 261..539 | CDD:238121 | 73/281 (26%) | ||
| WD40 repeat | 264..299 | CDD:293791 | 9/27 (33%) | ||
| WD40 repeat | 305..339 | CDD:293791 | 10/33 (30%) | ||
| WD40 repeat | 344..381 | CDD:293791 | 2/36 (6%) | ||
| WD40 repeat | 388..421 | CDD:293791 | 6/32 (19%) | ||
| WD40 repeat | 427..461 | CDD:293791 | 14/36 (39%) | ||
| WD40 repeat | 467..510 | CDD:293791 | 14/51 (27%) | ||
| WD40 repeat | 516..538 | CDD:293791 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||