DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Tle7

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001357768.1 Gene:Tle7 / 102638837 MGIID:5439433 Length:430 Species:Mus musculus


Alignment Length:290 Identity:63/290 - (21%)
Similarity:111/290 - (38%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WAIGQNECFMSLTGHNRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRT-L 108
            |.:|       ...|.:.::.:..:.....||:. ..|.||.||.|:      |:...::.:. |
Mouse   139 WRVG-------TLRHGKRVNAIAISSAPCHVYTC-GTGYIRVWDENA------LHASDRAPQAQL 189

  Fly   109 DFN------------PSGEYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIA 161
            ||.            |..:.:::|.....:.|||:.....    .|..|:...|:.:|   |.::
Mouse   190 DFQDPRNRVLTCKLFPDEQSLITGGMARGLTLWDLAPTPQ----VRAQMASTGSICYS---LALS 247

  Fly   162 S------AGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEH 220
            |      |..:|.:.|||::  .||:....:.|..|..||....|:|.  .|..|.|:..:||..
Mouse   248 SDAHLCLASFKGFVEIWDVQ--NQILIRKHEVPPYASRCVDITGFKFW--TGGEDTTLYSWDLRS 308

  Fly   221 QQLVSQTTHFYGQAIRCITFSDNGECLFVG-SSSGISVIGWEPDRELDHIKSTWSSLADMKVVNN 284
            .|.:.|  |.....|..||...:.|.:..| ..|.:.::....:.:...|...::...::|..: 
Mouse   309 YQKLQQ--HSLCHEILSITHDPSEEWVLAGLKMSDVVILHAHREEKYKAIVQRYTQHHNLKFAS- 370

  Fly   285 KLICGCHEIDTVSINTISLDRVIPFYQPPN 314
               ||.:.:.|       ||.||.....|:
Mouse   371 ---CGTYFMAT-------LDEVIHCLAAPS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 63/290 (22%)
WD40 14..260 CDD:238121 53/234 (23%)
WD40 repeat 22..58 CDD:293791 2/12 (17%)
WD40 repeat 63..99 CDD:293791 8/35 (23%)
WD40 repeat 106..142 CDD:293791 8/48 (17%)
WD40 repeat 148..184 CDD:293791 11/41 (27%)
WD40 repeat 192..228 CDD:293791 11/35 (31%)
WD40 repeat 285..310 CDD:293791 7/24 (29%)
Tle7NP_001357768.1 WD40 <146..422 CDD:225201 61/276 (22%)
WD40 repeat 152..191 CDD:293791 10/45 (22%)
WD40 repeat 199..236 CDD:293791 7/40 (18%)
WD40 repeat 241..275 CDD:293791 10/38 (26%)
WD40 repeat 283..316 CDD:293791 11/36 (31%)
WD40 repeat 321..361 CDD:293791 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.