| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001120009.1 | Gene: | wdr77 / 100144971 | XenbaseID: | XB-GENE-972898 | Length: | 333 | Species: | Xenopus tropicalis |
| Alignment Length: | 244 | Identity: | 64/244 - (26%) |
|---|---|---|---|
| Similarity: | 100/244 - (40%) | Gaps: | 48/244 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 ADDIGIIRRWDLNSQKIY----STLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNE---N 135
Fly 136 NCIKVCRGHMSHVNSVKFSP--DGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFH 198
Fly 199 P-FEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISV----- 257
Fly 258 -----------------IGWEPDRELDHIKST---WSSLADMKVVNNKL 286 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 64/244 (26%) | ||
| WD40 | 14..260 | CDD:238121 | 52/213 (24%) | ||
| WD40 repeat | 22..58 | CDD:293791 | |||
| WD40 repeat | 63..99 | CDD:293791 | 5/24 (21%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 11/38 (29%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 11/36 (31%) | ||
| WD40 repeat | 285..310 | CDD:293791 | 1/2 (50%) | ||
| wdr77 | NP_001120009.1 | WD40 | <43..312 | CDD:225201 | 61/237 (26%) |
| WD40 | 70..>297 | CDD:295369 | 53/215 (25%) | ||
| WD40 repeat | 73..110 | CDD:293791 | 4/22 (18%) | ||
| WD40 repeat | 119..154 | CDD:293791 | 10/34 (29%) | ||
| WD40 repeat | 160..197 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 205..242 | CDD:293791 | 11/37 (30%) | ||
| WD40 repeat | 248..273 | CDD:293791 | 4/24 (17%) | ||
| WD40 repeat | 290..312 | CDD:293791 | 9/28 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||