DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment disco and BNC2

DIOPT Version :9

Sequence 1:NP_001033847.1 Gene:disco / 32579 FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_060107.3 Gene:BNC2 / 54796 HGNCID:30988 Length:1099 Species:Homo sapiens


Alignment Length:451 Identity:125/451 - (27%)
Similarity:179/451 - (39%) Gaps:134/451 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RRWGSPPINLAGQFINPATGKKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMVFSS 133
            ||.||            |:.|.||.|:.|.|||.|||.||||::||||:..|:||:|||||||||
Human   430 RRMGS------------ASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSS 482

  Fly   134 RRSRNRHSANPNPKLHSPHIRRK------------ISPHDGRTAQQFPVFSPG-------TAAAA 179
            .||||||||||||:||.|.:|..            .:|....|.....:.|||       |....
Human   483 LRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLALTSPGRPPMGFTTPPLD 547

  Fly   180 AAVAGRLP--VAFPGL--LPPPPPHHGH--HPYVMFGGQAGLHGLGLLSTGCQDPDSGSVDNEQD 238
            ..:...||  :.|.||  :.|.||.:..  .|..|......|....::      |.||::  ||.
Human   548 PVLQNPLPSQLVFSGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPII------PTSGTI--EQH 604

  Fly   239 ADP--------------EDDNDFVYVDMQANSSSP----------AASSEDQEEHERD-----NE 274
            ..|              |...|.........||.|          |...:|:::...|     |:
Human   605 PPPPSEPVVPAVMMATHEPSADLAPKKKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGAVVND 669

  Fly   275 QDEEMHCSLSLASSSSIAADEERAADQPL-DFSLHKR---------RKSEQDREQEQEQEQERER 329
            ...:.||.          :.||.:....: |||.|.|         |:::....::||.|::.|.
Human   670 MSHDNHCH----------SQEEMSPGMSVKDFSKHNRTRCISRTEIRRADSMTSEDQEPERDYEN 724

  Fly   330 EAEKEQ----EQDVESDKEH--------------EPEQEH---------ELEREKRSPS-DAFSM 366
            |:|..:    |:.:|.| ||              .|::.|         :::.|...|: |.|.|
Human   725 ESESSEPKLGEESMEGD-EHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYM 788

  Fly   367 DQLLGKRKRHDSTASSSACSTAAASSASSSSASASANPPQTSIKMDL--DPDSDSAYMTSR 425
            .|.        ...:....|.||...:.:||.: ..:|.:.|.:.||  .||....|:..:
Human   789 SQY--------GLYNGGGASMAALHESFTSSLN-YGSPQKFSPEGDLCSSPDPKICYVCKK 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
discoNP_001033847.1 None
BNC2NP_060107.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..423
C2H2 Zn finger 443..464 CDD:275368 13/20 (65%)
C2H2 Zn finger 471..489 CDD:275368 15/17 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..641 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..742 23/104 (22%)
C2H2 Zn finger 835..856 CDD:275368 1/6 (17%)
C2H2 Zn finger 863..881 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 929..948
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1008
C2H2 Zn finger 1037..1058 CDD:275368
C2H2 Zn finger 1065..1083 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1079..1099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158834
Domainoid 1 1.000 85 1.000 Domainoid score I8179
eggNOG 1 0.900 - - E1_2C0EZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59377at33208
OrthoFinder 1 1.000 - - FOG0002551
OrthoInspector 1 1.000 - - mtm8668
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15021
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3798
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.