DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment disco and bnc-1

DIOPT Version :9

Sequence 1:NP_001033847.1 Gene:disco / 32579 FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001041125.1 Gene:bnc-1 / 4363106 WormBaseID:WBGene00044791 Length:205 Species:Caenorhabditis elegans


Alignment Length:63 Identity:49/63 - (77%)
Similarity:52/63 - (82%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSP 151
            |:||.|.||.|:||||||||||.|||||||||.|||.||...|||||||||||:|.|||||.|
 Worm   104 KRRVACDICSKSFCDKGALKIHTSAVHLREMHTCTVTGCGKQFSSRRSRNRHSSNNNPKLHMP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
discoNP_001033847.1 None
bnc-1NP_001041125.1 C2H2 Zn finger 109..130 CDD:275370 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C0EZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59377at33208
OrthoFinder 1 1.000 - - FOG0002551
OrthoInspector 1 1.000 - - otm14397
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3798
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.