powered by:
Protein Alignment disco and bnc-1
DIOPT Version :9
Sequence 1: | NP_001033847.1 |
Gene: | disco / 32579 |
FlyBaseID: | FBgn0000459 |
Length: | 568 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041125.1 |
Gene: | bnc-1 / 4363106 |
WormBaseID: | WBGene00044791 |
Length: | 205 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 49/63 - (77%) |
Similarity: | 52/63 - (82%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 KKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSP 151
|:||.|.||.|:||||||||||.|||||||||.|||.||...|||||||||||:|.|||||.|
Worm 104 KRRVACDICSKSFCDKGALKIHTSAVHLREMHTCTVTGCGKQFSSRRSRNRHSSNNNPKLHMP 166
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
disco | NP_001033847.1 |
None |
bnc-1 | NP_001041125.1 |
C2H2 Zn finger |
109..130 |
CDD:275370 |
16/20 (80%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160166353 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C0EZ |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D59377at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002551 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14397 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3798 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.870 |
|
Return to query results.
Submit another query.