DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment disco and LOC100536790

DIOPT Version :9

Sequence 1:NP_001033847.1 Gene:disco / 32579 FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_009295450.1 Gene:LOC100536790 / 100536790 -ID:- Length:523 Species:Danio rerio


Alignment Length:350 Identity:98/350 - (28%)
Similarity:139/350 - (39%) Gaps:101/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FMSPAYLLGHGPHS----HQHVHSHLPSHPQPNAASPASS---PGGSSGSGSGSAAGSGTGSGSS 65
            |:.|.:.  ..|||    ||.: ..|..|.:.:.:..|.|   |...:...|.|...|||...||
Zfish   221 FLQPFHY--SSPHSAAPEHQKL-QRLSKHSRRSTSQLACSTKPPKRHAEGDSPSGDSSGTQERSS 282

  Fly    66 LKPRRWGSPPINLAGQFINPATGKKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMV 130
            |                     .|.||.|..|.|||.|||.|||||:||||:..|:|||:||||:
Zfish   283 L---------------------SKGRVSCDACAKTFYDKGTLKIHFNAVHLKIKHRCTVDGCNMM 326

  Fly   131 FSSRRSRNRHSANPNPKLH--SPHIRRKISPHDGRTAQQFPVFSPGTAAAAAAVAGRLPVAFPGL 193
            |||.||||||||||||:||  :.|..|:.      |||                           
Zfish   327 FSSLRSRNRHSANPNPRLHAAAEHAVRRF------TAQ--------------------------- 358

  Fly   194 LPPPPPHH------GHHPYVMFGGQAGLHGLGLLSTGCQD--PDSGSVDNEQDADPEDDNDFVYV 250
                |.||      .|            ..:..:||..|.  ||:..:.........:.|:.:.|
Zfish   359 ----PRHHVLRLNTSH------------VSMATVSTEPQKQRPDTCEISGRAMNCSANQNEPINV 407

  Fly   251 ---DMQANSSSPAASSEDQEEHER----DNEQDEEMHCSLSLASSSSIAADEERAADQPLDF--- 305
               .....||:|.....|:::.::    ..:|...:|.:.||..::.:..|.:......|.:   
Zfish   408 TPKKKSRKSSTPLKIRRDEDDDDQFMISPRQQFYSLHGNQSLIKNTRMQYDYKHLRKAELGYHSN 472

  Fly   306 SLHKRRKSE-QDREQEQEQEQERER 329
            |||...:.: ..||..:..:|.:.|
Zfish   473 SLHMGERDDWMQREITESHDQCKAR 497



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59377at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.