DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8958 and pkg-2

DIOPT Version :9

Sequence 1:NP_573105.1 Gene:CG8958 / 32575 FlyBaseID:FBgn0030725 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_741467.1 Gene:pkg-2 / 177659 WormBaseID:WBGene00015650 Length:617 Species:Caenorhabditis elegans


Alignment Length:383 Identity:79/383 - (20%)
Similarity:147/383 - (38%) Gaps:102/383 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAVIMNQTWLSDEEEQGISMNVKKNV---ALMRQKRKPGMLTVADKALLR-----SNPAYRTIEE 83
            |..::.:..|.|:    |...::|.:   .:|...||..:.:..|..:.|     |:.|:.||..
 Worm     5 REALLAELELKDD----IIEQLRKELDEYRMMNTTRKTAISSEPDIQVKRPIIGKSDAAFETIGN 65

  Fly    84 RKKLCILIAGLNCFSRIPPKIRARMVPVLKFMSINEPRVIIKNGDMPISVYFILNGEVEMKKNTN 148
            ..:|...:..|:. ::| .||.:.|.||    .:....:||:.||:...:|.|..|:|::.|  :
 Worm    66 ALRLNSFLRNLDA-TQI-EKISSAMYPV----EVPAGAIIIRQGDLGSIMYVIQEGKVQVVK--D 122

  Fly   149 NKAVK-LEDAVAEAIFGPGDCFGDVEMVEECPRMNTYLALSSCEVLSIYDIDYER-ILKPHMLKQ 211
            |:.|: :||         |..||::.::..|.|..|..|:.||.:.:|     || :....|::.
 Worm   123 NRFVRTMED---------GALFGELAILHHCERTATVRAIESCHLWAI-----ERNVFHAIMMES 173

  Fly   212 WNEKKLALKAFDYF----------------DFLT-------------PDQIILACKYSYLVQYE- 246
            ..||.::.|....:                :|.|             |..:.|.|:.|.|...: 
 Worm   174 AREKTMSFKRHLKYSARFGGYPEEVLLRIAEFCTEMRYDAREELVVKPQYVYLVCRGSVLCDDQG 238

  Fly   247 PLETIYMGDTDSLGYVR-------FVLSGECVILQ------CLSMKVTNTEGEVNYELTEINKDD 298
            .:..|..|....|...|       |||.|...:::      |.::..|:.:.|:....:.     
 Worm   239 EVSKIVAGQDFELRCGRKGRFERFFVLEGPAHLIKMHVEQLCKALDTTDLDDEIRPRASS----- 298

  Fly   299 GLEMFQSWKDVTSRNSFLDIQDILASSTSS-------EEVEGGTKKKQAMRKMGLAEI 349
                       |...:.::::|:...||..       |.|...:.:..|::.|..|.|
 Worm   299 -----------TIEEADVELEDLQRVSTLGMGGFGRVELVRSASSRTYALKIMNKAHI 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8958NP_573105.1 Crp 97..>212 CDD:223736 32/116 (28%)
CAP_ED 97..207 CDD:237999 31/111 (28%)
pkg-2NP_741467.1 Crp 66..>173 CDD:223736 34/128 (27%)
CAP_ED 72..173 CDD:237999 33/122 (27%)
PTZ00263 295..599 CDD:140289 10/67 (15%)
STKc_cGK 316..572 CDD:270724 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.