DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8958 and egl-4

DIOPT Version :9

Sequence 1:NP_573105.1 Gene:CG8958 / 32575 FlyBaseID:FBgn0030725 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001294450.1 Gene:egl-4 / 176991 WormBaseID:WBGene00001173 Length:783 Species:Caenorhabditis elegans


Alignment Length:286 Identity:54/286 - (18%)
Similarity:109/286 - (38%) Gaps:94/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KNVALMRQ----KRKPGML-----TVADKALLRSNPAYRTIEERKKLC--ILIAGLNCFSRIPPK 103
            |.:|:..:    :.||..|     ||..|.::|.  |.:..:..|:|.  .:|..:||..    :
 Worm   161 KKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRD--AVQKNDFLKQLAKEQIIELVNCMY----E 219

  Fly   104 IRARMVPVLKFMSINEPRVIIKNGDMPISVYFILNGEVEMKKNTNNKAVKLEDAVAEAIFG---P 165
            :|||           ..:.:|:.|:....::.:..||:::.:.             .|:.|   .
 Worm   220 MRAR-----------AGQWVIQEGEPGDRLFVVAEGELQVSRE-------------GALLGKMRA 260

  Fly   166 GDCFGDVEMVEECPRMNTYLALSSCEV----LSIYDIDYER------------ILKPHMLKQWNE 214
            |...|::.::..|.|..:..||:..::    .|::.:..:|            :.|..:.:..:|
 Worm   261 GTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSE 325

  Fly   215 KKLALKA----FDYFDFLTPDQIILACKYSYLVQYEPLETIYMGDTDSLGYVRFVL-SGECVILQ 274
            .:::..|    .||:|           ...|:::        .|:....|...||: ||:     
 Worm   326 DRISKMADVMDQDYYD-----------GGHYIIR--------QGEKCLQGDAFFVINSGQ----- 366

  Fly   275 CLSMKVT-NTEGEVN-YELTEINKDD 298
               :||| ..|||.. .|:..:|:.|
 Worm   367 ---VKVTQQIEGETEPREIRVLNQGD 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8958NP_573105.1 Crp 97..>212 CDD:223736 18/133 (14%)
CAP_ED 97..207 CDD:237999 18/128 (14%)
egl-4NP_001294450.1 Crp 195..>316 CDD:223736 23/148 (16%)
CAP_ED 201..314 CDD:237999 22/140 (16%)
Crp 313..>427 CDD:223736 22/104 (21%)
CAP_ED 319..437 CDD:237999 21/98 (21%)
PTZ00263 461..779 CDD:140289
STKc_cGK 478..739 CDD:270724
S_TK_X 734..783 CDD:214529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.