DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8958 and cnbd2

DIOPT Version :9

Sequence 1:NP_573105.1 Gene:CG8958 / 32575 FlyBaseID:FBgn0030725 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_031759780.1 Gene:cnbd2 / 100486705 XenbaseID:XB-GENE-6046903 Length:595 Species:Xenopus tropicalis


Alignment Length:270 Identity:53/270 - (19%)
Similarity:106/270 - (39%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VKKNVALMRQKRK-PGMLTVADKALLRS----------------NPAYRTIEERKKLCILIAGLN 95
            :|:.....:.||| .|.|:. |.:|.:|                .|..|:.::.:.:..::.|:.
 Frog    60 MKEQETSKKGKRKNKGSLSF-DSSLFKSQYEFTFPEKAIEVALRRPEQRSEQDIRFIRSMMMGIL 123

  Fly    96 CFSRIPPKIRARMVPVLKFMSINEPRVIIKNGDMPISVYFILNGEVEMKKNTNNKAVKLEDAVAE 160
            .|.|...:::..:..|:.:......|||::.|....|.||:.:|.:.:.::.:..:..|:.  ..
 Frog   124 SFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSGVIAVTQDVDGSSALLDP--EP 186

  Fly   161 AIFGPGDCFGDVEMVEECPRMNTYLALSSCEVLSI---------YDIDYERILK---PH-----M 208
            .:...|..||:|.::::..|..|.:.:...|.|.:         .|.:.::.||   .|     :
 Frog   187 ILLHKGASFGEVALLKDLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDL 251

  Fly   209 LKQWNEKKLALKAFDYFDFLTPDQIILACKYSYLVQYEPLETIYMGDTDSLGYVRFVLSGECVIL 273
            ...|::|.|...|    |....::    |.:|         .:.:.||.....:.||..|.|.:|
 Frog   252 FSSWSDKSLETLA----DHCKAEE----CHHS---------QVMVKDTHETKNIIFVTKGRCEVL 299

  Fly   274 ------QCLS 277
                  ||.|
 Frog   300 RLVHLSQCPS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8958NP_573105.1 Crp 97..>212 CDD:223736 24/131 (18%)
CAP_ED 97..207 CDD:237999 23/121 (19%)
cnbd2XP_031759780.1 CAP_ED 125..243 CDD:237999 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253607at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.