DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and Btg4

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_062366.2 Gene:Btg4 / 56057 MGIID:1860140 Length:250 Species:Mus musculus


Alignment Length:271 Identity:76/271 - (28%)
Similarity:107/271 - (39%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFVISYL--YNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLK--TG 61
            |..||..|:.||...:  :.||..:::..|..:|...|.:|::.||:|:.|.||.|:||::  ..
Mouse     1 MRDEIATAVFFVTRLVKKHEKLSTQQIETFALKLMTILFEKYRGHWHPDCPSKGQAFRCIRINNN 65

  Fly    62 DPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYT--------ENNE 118
            :..|.|||||..||.|....:  .||.|:::|:||.||..|.|||   |..:|        ||.|
Mouse    66 ENKDPVLERACAESNVNFFHL--GLPKEMTIWVDPYEVCCRYGEK---KHPFTIASFKGRWENWE 125

  Fly   119 -------------------NHEDSHSADRE---VTKMFNPEAQCFRPIDAVNTTMN-NMSLSP-- 158
                               ...|..|..||   :.|:.||:        :|....| ..||.|  
Mouse   126 LAQHVSCAVNRATGDCSSGTSSDEESCSREAQIIPKVNNPK--------SVYQVENFKQSLQPWF 182

  Fly   159 ----KGHHQSGSSPHSAASSSPTYKGSP-NRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAP 218
                :.|...|......|:..|..|.|. .|..|..........:...||.           |||
Mouse   183 CLPRRKHLADGRGFLPGAACHPVPKSSKWCRPASRRVDRYHWVNAQLFSGQ-----------TAP 236

  Fly   219 GPVPGNGATAN 229
            |. ||..|.::
Mouse   237 GE-PGEEALSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 43/114 (38%)
Btg4NP_062366.2 BTG 1..114 CDD:369496 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.