DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and tob1

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001016611.1 Gene:tob1 / 549365 XenbaseID:XB-GENE-852943 Length:310 Species:Xenopus tropicalis


Alignment Length:369 Identity:141/369 - (38%)
Similarity:188/369 - (50%) Gaps:114/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKTGDPID 65
            |.:||:|||||:||||||||||||||||||||||.|::|::.||||::|:|||.:||:..|:.::
 Frog     1 MQLEIKVALNFIISYLYNKLPRRRVNIFGEELEKLLKNKYEGHWYPDRPYKGSGFRCIHVGEKVE 65

  Fly    66 SVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENHEDSHSADREV 130
            .::::||.|||:.|.||..|||.:|||||||.|||::|||||.:|:||.:  :|.|:....|:|:
 Frog    66 PIIQQAANESGLEIEDIRRNLPQDLSVWIDPSEVSYQIGEKGQIKVLYVD--DNSENGTELDKEI 128

  Fly   131 TKMFNPEAQCFRPIDAVNTTMNNMSLSPKGHHQSGSSPHSAASSSPTYKGSP--NRTISGSCSSV 193
            ...||||||.|.||       |:.|              |:.||||    ||  |.|.       
 Frog   129 KNSFNPEAQAFMPI-------NDQS--------------SSVSSSP----SPLFNETA------- 161

  Fly   194 SGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAAFMQRGAQAPLTFTTATFAQTKFGS 258
                                                |.:..||.|..| |||||||.||.|||||
 Frog   162 ------------------------------------AVSPTFMPRLNQ-PLTFTTAMFAATKFGS 189

  Fly   259 TKLKTSSKRTNSSSAYRMSPTEFS---NYIKQRAMQQQMHHGHAV-VPSAGSSVSAAYGGMDAVS 319
            ||:|     .|.:...|.|||:|.   |.::|.|:...||..:.: :|...|             
 Frog   190 TKMK-----NNRNKIARSSPTQFGLNVNLLQQSALSSSMHPMYGIGLPQKPS------------- 236

  Fly   320 PARSLSPNPLSLAGNQNQSVSGSSADSYYYPNMPINMYPQYGNP 363
               :||||                |..:.:|::|....|..|.|
 Frog   237 ---ALSPN----------------AQEFSFPSIPDPGRPAIGCP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 70/110 (64%)
tob1NP_001016611.1 BTG 1..106 CDD:387617 66/104 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3826
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3513
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000571
OrthoInspector 1 1.000 - - otm48703
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5717
SonicParanoid 1 1.000 - - X3071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.