DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and Btg3

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_062163.2 Gene:Btg3 / 54230 RGDID:2226 Length:252 Species:Rattus norvegicus


Alignment Length:237 Identity:68/237 - (28%)
Similarity:105/237 - (44%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKTG--DPIDSVLERAARESGVPI 79
            ::||.:..|..|.|:|.:.|::|:::|||||||.||.||||::..  ..:|..:.:|...|.:..
  Rat    19 HDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILY 83

  Fly    80 GDILENLPNELSVWIDPGEVSFRIGEKGAVKILYT-ENNENHEDSHSADREVTKMFNPEAQCFRP 143
            .|:  .||.||::|:||.||..|.|||....|:.: ||.:.::|      |::|..:      |.
  Rat    84 SDL--GLPKELTLWVDPCEVCCRYGEKNNAFIVASFENEDENKD------EISKKVS------RA 134

  Fly   144 IDAVNTTMNNMSLSPKGHHQSGSS-------------PHSAASS-SPTYKGS------------- 181
            :|.|.:           .:.||||             |.:.|:: ||.|:.|             
  Rat   135 LDKVTS-----------DYHSGSSSSDEDTSKEVEVKPSAVATTPSPVYQISELIFPPLPMWHPL 188

  Fly   182 PNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPG 223
            |.:.          .|...|.|.:|   |.|.|.....|.||
  Rat   189 PRKK----------PGMYRGGGHQS---HYPPPVPFAYPSPG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 38/96 (40%)
Btg3NP_062163.2 btg1 1..108 CDD:128410 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..162 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.