DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and btg3

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001313635.1 Gene:btg3 / 492479 ZFINID:ZDB-GENE-031113-19 Length:241 Species:Danio rerio


Alignment Length:219 Identity:64/219 - (29%)
Similarity:96/219 - (43%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKTG--DPIDSVLERAARESGVPIGD 81
            ||...:|::|.|.|..||::|::.||||:.|.||.|:||::..  ...|:.|.||..||||...|
Zfish    21 KLDADKVDLFVERLTVALQEKYKGHWYPDNPSKGQAFRCIRVNRFQKEDAELLRACAESGVQYKD 85

  Fly    82 ILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENHEDSHSADREVTKMFNPEAQCFRPIDA 146
            :  .||.||::|:|||||..|.|||.....:.|.::|:.:|.....::||             .|
Zfish    86 L--GLPKELTLWVDPGEVCCRYGEKNHGFTVATFSSEDDDDKEDVTKKVT-------------SA 135

  Fly   147 VNTTMNNMSLSPKGHHQSGSSPHSAAS------SSPTYKGSPNRTISGSCSSVSGAGSGTGSGSR 205
            |....::        :.||||.....|      ::|.:...|.:.:                   
Zfish   136 VERVTSD--------YHSGSSSDEDISCREIQYTTPLHNQPPYQVV------------------- 173

  Fly   206 SGSNHAPGPGTAPGP----VPGNG 225
                :|..||..|.|    .||.|
Zfish   174 ----YASAPGWHPVPRKKFGPGKG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 42/94 (45%)
btg3NP_001313635.1 BTG 1..115 CDD:285041 42/95 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.