DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and btg5.3

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_989017.1 Gene:btg5.3 / 394613 XenbaseID:XB-GENE-5805799 Length:225 Species:Xenopus tropicalis


Alignment Length:215 Identity:60/215 - (27%)
Similarity:88/215 - (40%) Gaps:55/215 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFV--ISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKTG-D 62
            |..||...:|::  ::..:::|....|..|||.|.:.|..::..|||||||.||.||||::.. .
 Frog     1 MREEIVTGVNYLKALACRFHRLDPMVVEAFGERLVEILCRRYTGHWYPEKPMKGQAYRCIRINRH 65

  Fly    63 PIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENHEDSHSAD 127
            ..|..:..|....|:...|:  :||.|:::||||.|||.|:.||            ||       
 Frog    66 QTDESIAEACALCGISYTDL--SLPKEITLWIDPYEVSCRLREK------------NH------- 109

  Fly   128 REVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKGHHQSGSSPHSAASSSPTYKG----SPNRTISG 188
                           |....       |..|:.:....:|..|...:||:..|    ||     |
 Frog   110 ---------------PFTVA-------SFDPRDNRVLSTSLESKTPASPSDSGIDCSSP-----G 147

  Fly   189 SCSSVSGAGSGTGSGSRSGS 208
            ..|.|...|....||:.|.:
 Frog   148 LSSWVGDRGEDMDSGNDSSN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 41/113 (36%)
btg5.3NP_989017.1 BTG 1..114 CDD:311607 44/148 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.