DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and btg4

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_937754.2 Gene:btg4 / 378946 ZFINID:ZDB-GENE-031008-1 Length:258 Species:Danio rerio


Alignment Length:306 Identity:82/306 - (26%)
Similarity:120/306 - (39%) Gaps:65/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFV--ISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLK---- 59
            |..||...:.|:  ::..:.||.|.|...|..||...|.:.::.|||||.|.||.|:|||:    
Zfish     1 MKEEIAATVFFIARLAKKHGKLDRVRREKFAVELTSVLFENYKCHWYPENPTKGQAFRCLRMNRA 65

  Fly    60 -TGDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENHEDS 123
             |.||   |:|||..:|.: :.:.| .||.|:::|:||||||.|.|||.      |.......:.
Zfish    66 QTRDP---VIERACCQSDI-VYEYL-GLPKEMTIWVDPGEVSCRYGEKS------TPFCVTQFEG 119

  Fly   124 HSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKGHHQSGSSPHSAASSSPTYKGSPNRTISG 188
            ...|.|.::..|         :||              .::.|..||..||..          .|
Zfish   120 QKRDGEFSRRIN---------NAV--------------ERASSDYHSGTSSDE----------EG 151

  Fly   189 SCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAAFMQRGAQAPLTFTTATFAQ 253
            ..:|:    |.|.|.|.|.|...|.|...|       ..:|..:........|.|...:..|:.:
Zfish   152 GNTSM----SSTLSSSNSSSISVPEPKCIP-------TVSNPNSVYQFSEFGQPPPMQSWGTYPK 205

  Fly   254 TKFGSTKLKTSSKRTNSSSAYRMSPTEFSNYIKQRAM---QQQMHH 296
            .|..:|:.....:.:.||.........|..|....|.   :|..:|
Zfish   206 RKPYATEGYQQQQHSYSSGGPYQGHKSFKGYRPSYAFSGPRQDRYH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 47/117 (40%)
btg4NP_937754.2 BTG 1..114 CDD:285041 48/123 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.