DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and Btg4

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_006243097.1 Gene:Btg4 / 315650 RGDID:1308809 Length:250 Species:Rattus norvegicus


Alignment Length:180 Identity:59/180 - (32%)
Similarity:88/180 - (48%) Gaps:27/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFV--ISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLK--TG 61
            |..||..|:.||  ::..:.||..:::..|..:|...|.:|::.||:|:.|.||.|:||::  ..
  Rat     1 MRDEIATAVFFVTRLAKKHEKLSTQQIETFALKLMTVLFEKYRGHWHPDCPSKGQAFRCIRINNN 65

  Fly    62 DPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENN-----ENHE 121
            :..|.|||||..||.|....:  .||.|:::|:||.||..|.|||   |..:|..:     ||.|
  Rat    66 ENKDPVLERACSESNVNFFHL--GLPKEMTIWVDPFEVCCRYGEK---KHPFTIASFKGRWENWE 125

  Fly   122 DSHSADREVTK--------MFNPEAQCFRPIDAVNTTMNNMSLSPKGHHQ 163
            .:.|....|.|        ..:.|..|.|...|: ..:||    ||..:|
  Rat   126 LAQSVSCAVNKATGDCSPSASSDEESCGREAQAI-PKVNN----PKSIYQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 43/114 (38%)
Btg4XP_006243097.1 BTG 1..115 CDD:285041 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.