DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tob and si:dkey-79d12.5

DIOPT Version :9

Sequence 1:NP_001162772.1 Gene:Tob / 32574 FlyBaseID:FBgn0028397 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_003200235.2 Gene:si:dkey-79d12.5 / 100538016 ZFINID:ZDB-GENE-131127-429 Length:267 Species:Danio rerio


Alignment Length:242 Identity:67/242 - (27%)
Similarity:105/242 - (43%) Gaps:47/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHIEIQVALNFV--ISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLK--TG 61
            |..|::..:||:  ::.....:.:.:..:|..:|::.|.:||..||||:.|.||.||||::  ..
Zfish     1 MKREVRAGVNFLKGLAVQRGGVDQIKAKLFASKLQELLLEKFTGHWYPDNPSKGQAYRCIRINAS 65

  Fly    62 DPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAV-------KILYTENNEN 119
            .|.|..:.:|..|||....::  ..|.|:::||||.||..|.||.|..       |:...|.:.|
Zfish    66 HPCDESVSKACMESGFKSSEL--GFPREITMWIDPMEVCVRSGENGRYFTVAHFDKVEDEEKDSN 128

  Fly   120 HEDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKGHHQSGSSPHSAASSSPT------- 177
            :.|:.|                 .:|:||       |....:|.:.||...:|.||.|       
Zfish   129 NNDTLS-----------------QVDSVN-------LDTSDYHSASSSDCGSAVSSDTEEEVKDN 169

  Fly   178 -YKGSPNRTISGS-CSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVP 222
             .:..|.||...: |:|.|.|....|. .:...:..|||.....|.|
Zfish   170 KLRKVPERTAESTLCTSRSKAREPKGR-RKFPPSQIPGPQYFYNPAP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TobNP_001162772.1 BTG 1..112 CDD:285041 39/121 (32%)
si:dkey-79d12.5XP_003200235.2 BTG 1..115 CDD:285041 38/115 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000571
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.