DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and PHO13

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_010045.1 Gene:PHO13 / 851362 SGDID:S000002395 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:20/92 - (21%)
Similarity:34/92 - (36%) Gaps:26/92 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LSDKEIIYALHTHNVRPDSMGS---YLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHL 114
            |..:.:.|.|...|:. ..:|.   ::.|..|...|...||       .||:.:.|.: :|.   
Yeast    37 LGSQALPYTLEILNLL-KQLGKQLIFVTNNSTKSRLAYTKK-------FASFGIDVKE-EQI--- 89

  Fly   115 WKYTGG---------FEKIDQAKEDLW 132
              :|.|         |.|:...|:.:|
Yeast    90 --FTSGYASAVYIRDFLKLQPGKDKVW 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252
PHO13NP_010045.1 HAD_Pase_UmpH-like 24..308 CDD:319813 20/92 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.