DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and nipsnap2

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001039092.1 Gene:nipsnap2 / 733910 XenbaseID:XB-GENE-5829147 Length:282 Species:Xenopus tropicalis


Alignment Length:259 Identity:120/259 - (46%)
Similarity:166/259 - (64%) Gaps:3/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEI--IYALHTHNVRPDSMGSYLNNY 79
            |:|.|:::..:...:||...|.|||::|.|::||.:|:.|||  :|.:..|||:|:.:.||....
 Frog    25 AIRGLASSSQKAREDSWLRSLFVRKVDPRKDAHSNLLAKKEISNLYKIQFHNVKPECLESYNKLC 89

  Fly    80 KTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQER 144
            :..:..|:..: :..|.||.:|....|:.||.:|||||.||:..:.:....|..:.|:....:.|
 Frog    90 EEVLPKIHADE-DYPCTLVGTWNTWYGEQDQAVHLWKYEGGYPALTEVMSKLRKNKEFTEFRKAR 153

  Fly   145 SKFLRSRHLQYLLAFSYWPQIASRTGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAG 209
            ...|.||..|.||.||:|.:...|.|.||||:|||:|.|||||||||:|||||.||:..:||.||
 Frog   154 GNMLLSRKNQLLLEFSFWNEPVPRNGPNIYELRSYQLRPGTMIEWGNHWARAIRYRQDGDEAVAG 218

  Fly   210 FFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSPSQ 273
            ||||||.||.|||:|.||.||.|.:.|.:||:..||||||.||||||:||..|::.|.:.||.|
 Frog   219 FFSQIGHLYMVHHLWAYKDLQTRDDIRNSAWQKDGWDECVYYTVPLIQEMESRIMIPLKSSPLQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252 62/96 (65%)
nipsnap2NP_001039092.1 NIPSNAP 183..280 CDD:311781 62/96 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4432
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1137
Inparanoid 1 1.050 260 1.000 Inparanoid score I3033
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1141024at2759
OrthoFinder 1 1.000 - - FOG0003040
OrthoInspector 1 1.000 - - otm49227
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1761
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.