DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and Nipsnap3a

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001155318.1 Gene:Nipsnap3a / 685080 RGDID:1583223 Length:247 Species:Rattus norvegicus


Alignment Length:262 Identity:62/262 - (23%)
Similarity:104/262 - (39%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KESHSRMLSDKEII------------------YALHTHNVRPDSMGSYLNNYKTTVALINEKKAN 92
            :.|..|||:.:.::                  |...|:.::|.::..:|.|:|..|.|     ..
  Rat     5 QSSLRRMLAPRALVHPVCPSFATDHRQREGTFYEFCTYYLKPSNVEEFLYNFKKNVHL-----RT 64

  Fly    93 LSCELVASWTVQVGD-MDQCLHLWKYTGGFEKI----DQAKEDLWNDPEYLSLMQERSKFL---- 148
            ...|||..|:|..|. ::...|:|||....::.    ..||::.|         |||  ||    
  Rat    65 AHSELVGYWSVGFGGRINTVFHIWKYDSYAQRAAVYKALAKDNDW---------QER--FLIPNL 118

  Fly   149 -----RSRHLQYLLAFSYWPQIASRTGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFA 208
                 :...:.||:.   |.::.:...:.:||:.::.:.||....||:.:.||:|  .|.|:.:.
  Rat   119 PFIDKQESEITYLVP---WCKLGTPPKEGVYELATFLMKPGGPALWGDAFERAVN--AHANQGYV 178

  Fly   209 G----FFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEF 269
            .    |.|:.|.|..||.:|..:....|...|..|...|.....|..:|..:.......|.|..|
  Rat   179 KLIGVFHSEYGLLNRVHVLWWVEDADRRAAGRHQAHEDPKVVSAVRESVNYLDTQQNMFLIPWSF 243

  Fly   270 SP 271
            ||
  Rat   244 SP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252 27/100 (27%)
Nipsnap3aNP_001155318.1 NIPSNAP 37..136 CDD:285252 29/117 (25%)
NIPSNAP 146..245 CDD:285252 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2883
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1141024at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.