DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and Nipsnap3b

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_079899.1 Gene:Nipsnap3b / 66536 MGIID:1913786 Length:247 Species:Mus musculus


Alignment Length:224 Identity:59/224 - (26%)
Similarity:97/224 - (43%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGD-MDQCLHLWKYTGGFEK 123
            |...|:.::|.....:|.|:|.:|.|     .....|::..|||:.|. .::..|:||| ..|..
Mouse    37 YEFRTYFLKPSKTNEFLENFKNSVHL-----RTAHSEMIGYWTVEFGGRTNRVFHIWKY-DNFAH 95

  Fly   124 IDQAKEDLWNDPEYLSLMQERSKFL---------RSRHLQYLLAFSYWPQIASRTGKNIYEMRSY 179
            ....::.|..|.|:    |||  ||         :...:.||:.   |.:|.:...:.:||:.::
Mouse    96 RTAVRKALAKDKEW----QER--FLIPNLAFIDKQEVEITYLVP---WCKIGTPPKEGVYELATF 151

  Fly   180 RLTPGTMIEWGNNWARAIN-YRKHNNEAFAG-FFSQIGRLYNVHHIWCYKSLQDRKETREAAWRS 242
            ::.||....|||.:.||:| :.:.......| |.::.|.|..||.:|..:|...|...|..:...
Mouse   152 QMKPGGPALWGNAFKRAVNAHVELGYSTLVGVFHTEYGALNRVHVLWWNESADSRAAGRHWSHED 216

  Fly   243 PGWDECVAYTVPLIREMHCRVLAPTEFSP 271
            |.....|..:|..:.......|.||.|||
Mouse   217 PRVVAAVRESVSYLESQQNTFLIPTSFSP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252 27/98 (28%)
Nipsnap3bNP_079899.1 NIPSNAP 37..136 CDD:285252 29/113 (26%)
NIPSNAP 146..245 CDD:285252 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2883
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.