DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and NIPSNAP3B

DIOPT Version :10

Sequence 1:NP_573103.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_060846.2 Gene:NIPSNAP3B / 55335 HGNCID:23641 Length:247 Species:Homo sapiens


Alignment Length:89 Identity:25/89 - (28%)
Similarity:40/89 - (44%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CWTVVLDIVFNVLALPLMFFPSISGVMLGWGQYIGI---PSWFLLYAIQAIVSVFASAAIAFFEN 128
            |:|     :|.:.|....|.||:..:.||..  :||   .:.||| :..||..||....:....|
Human   295 CYT-----LFGLFATLGFFAPSLYIIPLGIS--LGIHPDRAAFLL-STMAIAEVFGRIGMGLVLN 351

  Fly   129 RQNALQTNRKIRRKWVRVLLNVIN 152
            |:..    |||..:.:.|:|..::
Human   352 REPI----RKIYIELICVILLTVS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_573103.1 NIPSNAP 174..271 CDD:429767
NIPSNAP3BNP_060846.2 NIPSNAP 37..136 CDD:429767
NIPSNAP 146..245 CDD:429767
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.