DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and Nipsnap3b

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001009422.1 Gene:Nipsnap3b / 313211 RGDID:1359688 Length:247 Species:Rattus norvegicus


Alignment Length:224 Identity:56/224 - (25%)
Similarity:98/224 - (43%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQV-GDMDQCLHLWKYTGGFE 122
            :|...|::::|....::|.|::..|.|     .....|::..|||:. |.:::..|:||| ..|.
  Rat    36 LYEFRTYSLKPSKTNAFLQNFQKYVHL-----RTAHSEMIGYWTVEFGGKINRVFHIWKY-DNFA 94

  Fly   123 KIDQAKEDLWNDPEY--------LSLMQERSKFLRSRHLQYLLAFSYWPQIASRTGKNIYEMRSY 179
            .....::.|..|.|:        |:.|.|:..     .:.||:.   |.:|.:...:.:||:.::
  Rat    95 HRTAVRKALAKDKEWQEQFLISNLAFMDEQEV-----EITYLVP---WCKIRTPPKEGVYELATF 151

  Fly   180 RLTPGTMIEWGNNWARAIN-YRKHNNEAFAG-FFSQIGRLYNVHHIWCYKSLQDRKETREAAWRS 242
            ::.||....||:.:.|||| :.:.......| |.::.|.|..||.:|...|...|...|..:...
  Rat   152 QMKPGGPALWGDAFKRAINAHVELGYSTLVGVFHTEYGALNRVHVLWWNDSADSRAAGRHWSHED 216

  Fly   243 PGWDECVAYTVPLIREMHCRVLAPTEFSP 271
            |.....|..:|..:.......|.||.|||
  Rat   217 PRVVAAVRESVNYLESQQNMFLIPTSFSP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252 27/98 (28%)
Nipsnap3bNP_001009422.1 NIPSNAP 37..136 CDD:285252 26/112 (23%)
NIPSNAP 146..245 CDD:285252 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2883
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1141024at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.