DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nipsnap and C45E5.1

DIOPT Version :9

Sequence 1:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_500857.2 Gene:C45E5.1 / 183469 WormBaseID:WBGene00016664 Length:303 Species:Caenorhabditis elegans


Alignment Length:149 Identity:27/149 - (18%)
Similarity:56/149 - (37%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLN 77
            :.||:.::|         |.:..|  |:|:...:.....:||...::......|     ...:.|
 Worm    54 TTNNSTKTL---------EQYMKK--VKKMRFGRLGRENLLSPTIVLCDYFKQN-----SDKFEN 102

  Fly    78 NYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQ 142
            .|...:.:.|.||           :::.|...:|..    ||...|      |.:.|.::::.:.
 Worm   103 QYIYLIGVENLKK-----------SLEEGGGVKCFG----TGPDHK------DNYTDGDFINEVD 146

  Fly   143 ERSKFLRSRHLQYLLAFSY 161
            .:||..::..:.:...|||
 Worm   147 VKSKIPKAVVVSFDSHFSY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252
C45E5.1NP_500857.2 HAD-SF-IIA 18..274 CDD:273637 27/149 (18%)
Hydrolase_6 18..121 CDD:290083 15/93 (16%)
Hydrolase_like 221..284 CDD:289983
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103770
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1761
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.