DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and CD86

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:195 Identity:40/195 - (20%)
Similarity:78/195 - (40%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 FFEE----PINSATSGDNLVSAVHLFTE----AVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNV 274
            :|.|    |...|.|.:..:|.:.:|.:    .||| .|.:.|:|        .:.|....:|..
Human    31 YFNETADLPCQFANSQNQSLSELVVFWQDQENLVLN-EVYLGKEK--------FDSVHSKYMGRT 86

  Fly   275 TYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPP----RVFTTN--LTVL----EPP 329
            ::..|           :|.|.::..|.:|.|:|.|.:....|    |:...|  |:||    :|.
Human    87 SFDSD-----------SWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPE 140

  Fly   330 LRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSAN---DAVQKLINETTSEL 391
            :..|.    ::.:..|     ::|.|.....:.:.::.::|..|.::.   |.|.:...:..:||
Human   141 IVPIS----NITENVY-----INLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTEL 196

  Fly   392  391
            Human   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 20/88 (23%)
Ig strand B 242..246 CDD:409433 2/3 (67%)
Ig strand C 255..264 CDD:409433 0/8 (0%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 2/4 (50%)
Ig <417..474 CDD:472250
CD86NP_787058.5 IgV_CD86 26..133 CDD:409508 27/121 (22%)
FR1 26..40 CDD:409508 2/8 (25%)
Ig strand A 26..31 CDD:409508 40/195 (21%)
Ig strand B 34..40 CDD:409508 1/5 (20%)
CDR1 41..52 CDD:409508 2/10 (20%)
FR2 53..60 CDD:409508 1/6 (17%)
Ig strand C 53..59 CDD:409508 1/5 (20%)
CDR2 62..82 CDD:409508 7/28 (25%)
Ig strand C' 64..69 CDD:409508 3/5 (60%)
Ig strand C' 72..74 CDD:409508 1/1 (100%)
FR3 83..115 CDD:409508 9/42 (21%)
Ig strand D 85..89 CDD:409508 0/3 (0%)
Ig strand E 93..99 CDD:409508 2/5 (40%)
Ig strand F 106..114 CDD:409508 3/7 (43%)
CDR3 116..118 CDD:409508 0/1 (0%)
FR4 119..133 CDD:409508 3/13 (23%)
Ig strand G 120..133 CDD:409508 3/12 (25%)
Ig 136..221 CDD:472250 11/70 (16%)
Ig strand B 152..157 CDD:409505 2/9 (22%)
Ig strand C 167..172 CDD:409505 0/4 (0%)
Ig strand E 201..205 CDD:409505
Ig strand F 215..220 CDD:409505
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.