DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and PAPLN

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:315 Identity:69/315 - (21%)
Similarity:106/315 - (33%) Gaps:95/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 RNHWTASGFARVT------ERPRSKHHHEHHWG-------------------PFFEEPINSATSG 229
            |..|.:.|..|..      |.|.::...|..||                   ||.......:.:|
Human   849 RKPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAPPFHSSSYRISLAG 913

  Fly   230 --DNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNW 292
              .:||.|. |.....|:|......:....| ::..:.:|           ..|.|::|    :.
Human   914 VEPSLVQAA-LGQLVRLSCSDDTAPESQAAW-QKDGQPIS-----------SDRHRLQF----DG 961

  Fly   293 RLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQI 357
            .|:|:|.|.||||.|.|. ||.|.|      ...:..||||.      ||....|      :.::
Human   962 SLIIHPLQAEDAGTYSCG-STRPGR------DSQKIQLRIIG------GDMAVLS------EAEL 1007

  Fly   358 SRSFFQKERQTILKSTDSAND-----------AVQKLINETTSELNLIGNVNQTQHKFSGQDL-- 409
            ||  |.:.|       |.|.|           |:.....:..:.|.|..|..:......||.:  
Human  1008 SR--FPQPR-------DPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRM 1063

  Fly   410 ----EKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSC 460
                |.:....|.|.:|.:|:.. ...:|......:.||:::     .|.|.|:|
Human  1064 TCRAEGFPPPAIEWQRDGQPVSS-PRHQLQPDGSLVISRVAV-----EDGGFYTC 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 21/82 (26%)
Ig <258..326 CDD:299845 19/67 (28%)
IGc2 <417..461 CDD:197706 11/44 (25%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 11/55 (20%)
Ig 914..>978 CDD:325142 20/80 (25%)
I-set 1049..1119 CDD:254352 14/70 (20%)
IG 1139..1219 CDD:214652
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.